DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13526 and Efcab11

DIOPT Version :9

Sequence 1:NP_611714.1 Gene:CG13526 / 37613 FlyBaseID:FBgn0034774 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_001019521.1 Gene:Efcab11 / 500705 RGDID:1565006 Length:162 Species:Rattus norvegicus


Alignment Length:129 Identity:29/129 - (22%)
Similarity:61/129 - (47%) Gaps:2/129 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 DAFEKYDLDSNGTLSANEVRLALISV-GYEITEAELYDLIHSVAVRDEERLDLKKFIRMMAPRMA 82
            :.|:..|.|:.|.||..:.::|::.: ||:.::.|. |.:.|.|..|...:.|:.|:.::..:..
  Rat    25 EVFKACDEDNKGYLSREDFKVAIVMLFGYKPSKIEA-DAVMSSANPDTSGVSLEGFLNVVQRKKE 88

  Fly    83 NVDSDKSLCRTFNMIDRDRDGYVTVQDVRAIMVVLGEVVTDDDIKDICQAVDMDGDGRISLRDF 146
            .......:...|...|....|::|::|.:.....:...:....:.::.:..|.|.||.:|.|||
  Rat    89 AQLYRNEIRHIFTAFDVHYRGFLTLEDFKRAFSQVAPKLPSRTVLEVFREADQDSDGHVSFRDF 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13526NP_611714.1 PTZ00184 7..152 CDD:185504 29/129 (22%)
EFh 16..78 CDD:238008 16/59 (27%)
EFh 92..151 CDD:238008 13/55 (24%)
Efcab11NP_001019521.1 EFh 25..84 CDD:298682 16/59 (27%)
EF-hand_7 25..83 CDD:290234 16/58 (28%)
EFh 95..152 CDD:238008 11/56 (20%)
EF-hand_7 96..156 CDD:290234 13/57 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1435392at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.