DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13526 and Calm5

DIOPT Version :9

Sequence 1:NP_611714.1 Gene:CG13526 / 37613 FlyBaseID:FBgn0034774 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_001008706.1 Gene:Calm5 / 494124 MGIID:3511177 Length:140 Species:Mus musculus


Alignment Length:121 Identity:22/121 - (18%)
Similarity:63/121 - (52%) Gaps:4/121 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 DSNGTLSANEVRLALISVGYEITEAELYDLIHSVAVRDEERLDLKKFIRMMAPRMANVDSDKSLC 91
            :.:|.::..|:...:..:|..::..||..||..:....:.::..::|.:    .:.....::.|.
Mouse    10 NKDGHINVQELGDVMKQLGKNLSHEELKALISKLDTDGDGKISFEEFFK----SIKKYTKEQELQ 70

  Fly    92 RTFNMIDRDRDGYVTVQDVRAIMVVLGEVVTDDDIKDICQAVDMDGDGRISLRDFV 147
            ..|:::|::.|||:||.:::..:..:||.::.::::.:......|.||:::...|:
Mouse    71 AMFSVLDQNGDGYITVDELKEGLSKMGEPLSQEELEGMIHVFGADQDGKVNYEQFL 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13526NP_611714.1 PTZ00184 7..152 CDD:185504 22/121 (18%)
EFh 16..78 CDD:238008 8/50 (16%)
EFh 92..151 CDD:238008 13/56 (23%)
Calm5NP_001008706.1 EFh 10..56 CDD:238008 7/45 (16%)
EFh 35..94 CDD:238008 13/62 (21%)
EF-hand_7 36..91 CDD:290234 12/58 (21%)
EFh 68..128 CDD:238008 14/59 (24%)
EF-hand_7 69..129 CDD:290234 14/58 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.