DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13526 and Eip63F-1

DIOPT Version :9

Sequence 1:NP_611714.1 Gene:CG13526 / 37613 FlyBaseID:FBgn0034774 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_524902.2 Gene:Eip63F-1 / 47878 FlyBaseID:FBgn0004910 Length:193 Species:Drosophila melanogaster


Alignment Length:160 Identity:43/160 - (26%)
Similarity:78/160 - (48%) Gaps:27/160 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 TNEHIDELRDAFEKYDLDSNGTLSANEVRLALISVGYEITEAELYDLI----HS----------- 59
            |...|.:||.||:..|.:.:|.::|||::..|.::|..:::..::|||    ||           
  Fly    33 TEVEIKDLRTAFDLLDRNRDGRVTANELQFMLKNLGINVSDELIHDLIREASHSGNGLINEAEFL 97

  Fly    60 ------VAVRDEERL--DLKKFIRMMAPRMANVDSDKSLCRTFNMIDRDRDGYVTVQDVRAIMVV 116
                  .|:|||:..  |.|.    ..|.....|..:.|...|.:.|||.:|::|..:::..|.:
  Fly    98 QWVGRIQALRDEQHSHEDSKD----SKPVDEADDVTEDLIAAFRVFDRDGNGFITRDELQTAMEM 158

  Fly   117 LGEVVTDDDIKDICQAVDMDGDGRISLRDF 146
            :||.:.:..::.:....|:|.||||:..:|
  Fly   159 IGEPLNEQQLEQLLVIADLDQDGRINYEEF 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13526NP_611714.1 PTZ00184 7..152 CDD:185504 43/160 (27%)
EFh 16..78 CDD:238008 22/84 (26%)
EFh 92..151 CDD:238008 16/55 (29%)
Eip63F-1NP_524902.2 PTZ00184 33..193 CDD:185504 43/160 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23050
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.