DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13526 and MYL5

DIOPT Version :9

Sequence 1:NP_611714.1 Gene:CG13526 / 37613 FlyBaseID:FBgn0034774 Length:154 Species:Drosophila melanogaster
Sequence 2:XP_006713949.1 Gene:MYL5 / 4636 HGNCID:7586 Length:328 Species:Homo sapiens


Alignment Length:152 Identity:30/152 - (19%)
Similarity:69/152 - (45%) Gaps:27/152 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FSGNELTNEHIDELRDAFEKYDLDSNGTLSANEVRLALISVGYEITEAELYDLIHSVAVRDEERL 68
            ||..|.|  .|.|.::||...|.:.:|.:...:::....|:|             ...|:|:| |
Human   179 FSNFEQT--QIQEFKEAFTLMDQNRDGFIDKEDLKDTYASLG-------------KTNVKDDE-L 227

  Fly    69 D--LKK---------FIRMMAPRMANVDSDKSLCRTFNMIDRDRDGYVTVQDVRAIMVVLGEVVT 122
            |  ||:         |:.:...:::..|:::::...|.|:|.|..|.:..:.::.:::...:.:|
Human   228 DAMLKEASGPINFTMFLNLFGEKLSGTDAEETILNAFKMLDPDGKGKINKEYIKRLLMSQADKMT 292

  Fly   123 DDDIKDICQAVDMDGDGRISLR 144
            .:::..:.|...:|..|.:..:
Human   293 AEEVDQMFQFASIDVAGNLDYK 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13526NP_611714.1 PTZ00184 7..152 CDD:185504 28/149 (19%)
EFh 16..78 CDD:238008 15/72 (21%)
EFh 92..151 CDD:238008 9/53 (17%)
MYL5XP_006713949.1 FRQ1 170..314 CDD:227455 30/150 (20%)
EFh 189..247 CDD:238008 15/71 (21%)
EFh 263..314 CDD:238008 9/50 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1435392at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.