DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13526 and myl12b

DIOPT Version :9

Sequence 1:NP_611714.1 Gene:CG13526 / 37613 FlyBaseID:FBgn0034774 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_001004813.1 Gene:myl12b / 448060 XenbaseID:XB-GENE-991019 Length:172 Species:Xenopus tropicalis


Alignment Length:133 Identity:25/133 - (18%)
Similarity:59/133 - (44%) Gaps:4/133 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 IDELRDAFEKYDLDSNGTLSANEVRLALISVGYEITEAELYDLIHSVAVRDEERLDLKKFIRMMA 78
            |.|.::||...|.:.:|.:...::...|.|:....|: |..|.:.:.|   ...::...|:.|..
 Frog    31 IQEFKEAFNMIDQNRDGFIDKEDLHDMLASLEKNPTD-EYLDAMMNEA---PGPINFTMFLTMFG 91

  Fly    79 PRMANVDSDKSLCRTFNMIDRDRDGYVTVQDVRAIMVVLGEVVTDDDIKDICQAVDMDGDGRISL 143
            .::...|.:..:...|...|.:..|.:....:|.::..:|:..||:::.::.:...:|..|..:.
 Frog    92 EKLNGTDPEDVIRNAFACFDEEGIGSIQEDTLRELLTTMGDRFTDEEVDELFREAPIDKKGNFNY 156

  Fly   144 RDF 146
            .:|
 Frog   157 NEF 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13526NP_611714.1 PTZ00184 7..152 CDD:185504 25/133 (19%)
EFh 16..78 CDD:238008 13/61 (21%)
EFh 92..151 CDD:238008 10/55 (18%)
myl12bNP_001004813.1 FRQ1 19..169 CDD:227455 25/133 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1435392at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.