DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13526 and CG17770

DIOPT Version :9

Sequence 1:NP_611714.1 Gene:CG13526 / 37613 FlyBaseID:FBgn0034774 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_651432.1 Gene:CG17770 / 43118 FlyBaseID:FBgn0039374 Length:164 Species:Drosophila melanogaster


Alignment Length:144 Identity:37/144 - (25%)
Similarity:75/144 - (52%) Gaps:3/144 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 NELTNEHIDELRDAFEKYDLDSNGTLSANEVRLALISVGYEITEAELYDLIHSVAVRDEERLDLK 71
            :.||.|.:.:|..||..:|......:....:|..::||.:..::.||.::...:.......|.|.
  Fly    18 HNLTEEQVKDLEIAFSLFDDQDTKVIPITNLRQLMLSVAHYPSDMELQEIQAEIDADGSGELYLS 82

  Fly    72 KFIRMMAPRMANVDSDKSLCRTFNMIDRDRDGYVTVQDVRAIMVVLGEVVTDDDIKDICQAVDMD 136
            .|:.:|:.|.||:.::..:...|.:.|::..|.::..:.|.||..:||.:|||::::|.:..:.|
  Fly    83 DFLHIMSQRYANMSTEDEIIAAFRVFDKEGTGLISESEFRHIMQNMGEQLTDDEVEEIIRDANSD 147

  Fly   137 GDGRISLRDFVGFM 150
            .:|.|   |:|.|:
  Fly   148 LEGNI---DYVRFV 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13526NP_611714.1 PTZ00184 7..152 CDD:185504 37/144 (26%)
EFh 16..78 CDD:238008 12/61 (20%)
EFh 92..151 CDD:238008 18/59 (31%)
CG17770NP_651432.1 PTZ00184 19..161 CDD:185504 37/143 (26%)
EFh 27..89 CDD:298682 12/61 (20%)
EFh 63..126 CDD:238008 14/62 (23%)
EFh 100..162 CDD:238008 18/62 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464476
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23050
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.