DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13526 and CG17272

DIOPT Version :9

Sequence 1:NP_611714.1 Gene:CG13526 / 37613 FlyBaseID:FBgn0034774 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_650917.1 Gene:CG17272 / 42465 FlyBaseID:FBgn0038830 Length:149 Species:Drosophila melanogaster


Alignment Length:144 Identity:27/144 - (18%)
Similarity:62/144 - (43%) Gaps:7/144 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 EHIDELRDAFEKYDLDSNGTL-SANEVRLALISVGYEITEAELYDLIHSVAVRDEERLDLKKFIR 75
            :.|||.|:.|  |....:|.: :.:|:.:.:.|:|...|..||.    |...:...::....|:.
  Fly     8 QDIDEFRECF--YLFARSGQINNLDELTVIMRSLGLSPTIQELV----SYLKQKNGKMSFADFLD 66

  Fly    76 MMAPRMANVDSDKSLCRTFNMIDRDRDGYVTVQDVRAIMVVLGEVVTDDDIKDICQAVDMDGDGR 140
            :|............:...|...|....|.::.:.:|.::...||.::..::.:|.:..:::.:..
  Fly    67 IMHQHSKVESLPDEVIAAFKAADPQNKGTISARQLRNLLQNWGEGLSMREVDNIFREANVNNNST 131

  Fly   141 ISLRDFVGFMHSPI 154
            :...|||....:|:
  Fly   132 VRYADFVKIACAPV 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13526NP_611714.1 PTZ00184 7..152 CDD:185504 26/140 (19%)
EFh 16..78 CDD:238008 13/62 (21%)
EFh 92..151 CDD:238008 10/58 (17%)
CG17272NP_650917.1 PTZ00184 1..143 CDD:185504 26/140 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443635
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23050
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.