DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13526 and pvalb6

DIOPT Version :9

Sequence 1:NP_611714.1 Gene:CG13526 / 37613 FlyBaseID:FBgn0034774 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_991136.1 Gene:pvalb6 / 402806 ZFINID:ZDB-GENE-040912-95 Length:109 Species:Danio rerio


Alignment Length:93 Identity:23/93 - (24%)
Similarity:45/93 - (48%) Gaps:6/93 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 AVRDEERLDLKKFIRMMAPRMANVDSDKSLCRTFNMIDRDRDGYVTVQDVRAIMVVL---GEVVT 122
            |.:..:..:.|.|..|:..:....|..|   :.|:::|.|..|::..::::.::...   |..:|
Zfish    18 ACKAPDSFNHKSFFEMVGLKAKASDDVK---KAFHLLDADNSGFIEEEELKFVLKAFATDGRDLT 79

  Fly   123 DDDIKDICQAVDMDGDGRISLRDFVGFM 150
            |.:.|...||.|.||||:|...:|...:
Zfish    80 DKETKAFLQAADKDGDGKIGAEEFAALV 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13526NP_611714.1 PTZ00184 7..152 CDD:185504 23/93 (25%)
EFh 16..78 CDD:238008 4/16 (25%)
EFh 92..151 CDD:238008 17/62 (27%)
pvalb6NP_991136.1 EFh_parvalbumin_like 10..109 CDD:330177 23/93 (25%)
EF-hand motif 10..38 CDD:319994 4/19 (21%)
EF-hand motif 43..72 CDD:319994 5/31 (16%)
EF-hand motif 82..109 CDD:319994 10/26 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1435392at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.