DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13526 and CG13898

DIOPT Version :9

Sequence 1:NP_611714.1 Gene:CG13526 / 37613 FlyBaseID:FBgn0034774 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_612058.1 Gene:CG13898 / 38092 FlyBaseID:FBgn0035161 Length:151 Species:Drosophila melanogaster


Alignment Length:138 Identity:40/138 - (28%)
Similarity:75/138 - (54%) Gaps:0/138 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LTNEHIDELRDAFEKYDLDSNGTLSANEVRLALISVGYEITEAELYDLIHSVAVRDEERLDLKKF 73
            |.|:.:.::.:|||..|.:..|.:.|:::...:.::|...||:|:|.....:.......:.|..|
  Fly     8 LANDDLQDICEAFELCDPEKTGRIRADDLGEVMRTLGQNHTESEIYRYSEGLEGDVNGYIQLTDF 72

  Fly    74 IRMMAPRMANVDSDKSLCRTFNMIDRDRDGYVTVQDVRAIMVVLGEVVTDDDIKDICQAVDMDGD 138
            |.:|....:.:.|...|...:|..|.|:||.||..::|.:.:.|||.::|::..::.:..|:|||
  Fly    73 IDLMTKIYSAMGSSDYLKAAYNAFDFDKDGLVTYGELRHVFINLGEKISDEEFNEVFRQADVDGD 137

  Fly   139 GRISLRDF 146
            |.|:.|||
  Fly   138 GVINFRDF 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13526NP_611714.1 PTZ00184 7..152 CDD:185504 40/138 (29%)
EFh 16..78 CDD:238008 14/61 (23%)
EFh 92..151 CDD:238008 21/55 (38%)
CG13898NP_612058.1 PTZ00184 8..146 CDD:185504 40/138 (29%)
EFh 18..77 CDD:298682 14/58 (24%)
EFh 88..148 CDD:238008 22/58 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443650
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23050
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.