DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13526 and CG9406

DIOPT Version :9

Sequence 1:NP_611714.1 Gene:CG13526 / 37613 FlyBaseID:FBgn0034774 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_611552.1 Gene:CG9406 / 37405 FlyBaseID:FBgn0034592 Length:186 Species:Drosophila melanogaster


Alignment Length:155 Identity:36/155 - (23%)
Similarity:66/155 - (42%) Gaps:8/155 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 GNELTNEHIDELRDAFEKYDLDSNGTLSANEVRLALISVGYEITEAELYDLIHSV-AVRDEERLD 69
            |..|.||..:::.:||..:|...:..:.:..|...|..:|...||.|:.|:|.:. :|.......
  Fly     4 GVTLNNELEEKISEAFCIFDTHGDKYIDSRNVGNVLRFLGCAPTEKEVEDVIKATDSVDYPGEAH 68

  Fly    70 LKKFI----RMMAPRMANVDSDKSLCRTFNMIDRDRDGYVTVQDVRAIMVVLGEVVTDDDIKDIC 130
            |.||:    :::..|.....|.:.|...|..:|.:...|:|.:....:|...||..:.::: |..
  Fly    69 LVKFMEHVSKLLMDRQMEPASSEKLLEAFETLDPENKKYLTKEYFGKLMAEEGEPFSAEEL-DAM 132

  Fly   131 QAVDMDG-DGRISLRDFVG-FMHSP 153
            ..|.:|. .|.|....::. ..|.|
  Fly   133 WPVAIDPITGHIPYTFYINQLRHKP 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13526NP_611714.1 PTZ00184 7..152 CDD:185504 33/151 (22%)
EFh 16..78 CDD:238008 15/66 (23%)
EFh 92..151 CDD:238008 12/60 (20%)
CG9406NP_611552.1 PTZ00184 7..156 CDD:185504 33/149 (22%)
EFh 14..>59 CDD:298682 11/44 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443664
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23050
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.