DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13526 and Cabp4

DIOPT Version :9

Sequence 1:NP_611714.1 Gene:CG13526 / 37613 FlyBaseID:FBgn0034774 Length:154 Species:Drosophila melanogaster
Sequence 2:XP_038941368.1 Gene:Cabp4 / 365394 RGDID:1306083 Length:278 Species:Rattus norvegicus


Alignment Length:152 Identity:48/152 - (31%)
Similarity:89/152 - (58%) Gaps:10/152 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ELTNEHIDELRDAFEKYDLDSNGTLSANEVRLALISVGYEITEAELYDLIHSVAVRDEERLDLKK 72
            ||..|.::||:.|||::|.|.:|.:...|:...:.::||..||.||.::...|.:|....:|.::
  Rat   121 ELGPEELEELQAAFEEFDTDQDGYIGHRELGDCMRTLGYMPTEMELLEVSQHVKMRMGGFVDFEE 185

  Fly    73 FIRMMAPRM----ANVDSDKSLCRTFNMIDRDRDGYVTVQDVR-AIMVVLGEVVTDDDIKDICQA 132
            |:.:::|::    |::...:.|...|...|:||||.:||.::| |...:|||.:...::.::.:.
  Rat   186 FVELISPKLREETAHMLGVRELRIAFREFDKDRDGRITVAELRQAAPALLGEPLEGTELDEMLRD 250

  Fly   133 VDMDGDGRISLRDFVGFMHSPI 154
            :|::|||.|   ||.|  .||:
  Rat   251 MDLNGDGTI---DFDG--ESPL 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13526NP_611714.1 PTZ00184 7..152 CDD:185504 46/148 (31%)
EFh 16..78 CDD:238008 19/61 (31%)
EFh 92..151 CDD:238008 21/59 (36%)
Cabp4XP_038941368.1 PTZ00184 133..262 CDD:185504 39/131 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.