DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13526 and TpnC41C

DIOPT Version :9

Sequence 1:NP_611714.1 Gene:CG13526 / 37613 FlyBaseID:FBgn0034774 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_001246139.1 Gene:TpnC41C / 35473 FlyBaseID:FBgn0013348 Length:154 Species:Drosophila melanogaster


Alignment Length:147 Identity:40/147 - (27%)
Similarity:78/147 - (53%) Gaps:3/147 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 NELTNEHIDELRDAFEKYDLDSNGTLSANEVRLALISVGYEITEAELYDLIHSVAVRDEERLDLK 71
            :|||.|....||:||..:|.:.||.::...|...|..:|:::.:|.|.|:|..|......:::.:
  Fly     3 DELTKEQTALLRNAFNAFDPEKNGYINTAMVGTILSMLGHQLDDATLADIIAEVDEDGSGQIEFE 67

  Fly    72 KFIRMMAPRMANVDSD---KSLCRTFNMIDRDRDGYVTVQDVRAIMVVLGEVVTDDDIKDICQAV 133
            :|..:.|..:...|::   ..|...|.:.|::.:||:|...:|.|:..|.:.:|:||:..:.:.:
  Fly    68 EFTTLAARFLVEEDAEAMMAELKEAFRLYDKEGNGYITTGVLREILRELDDKLTNDDLDMMIEEI 132

  Fly   134 DMDGDGRISLRDFVGFM 150
            |.||.|.:...:|:..|
  Fly   133 DSDGSGTVDFDEFMEVM 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13526NP_611714.1 PTZ00184 7..152 CDD:185504 40/147 (27%)
EFh 16..78 CDD:238008 16/61 (26%)
EFh 92..151 CDD:238008 17/59 (29%)
TpnC41CNP_001246139.1 PTZ00184 1..150 CDD:185504 40/147 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23050
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.