DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13526 and CG11638

DIOPT Version :9

Sequence 1:NP_611714.1 Gene:CG13526 / 37613 FlyBaseID:FBgn0034774 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_569879.1 Gene:CG11638 / 31050 FlyBaseID:FBgn0040351 Length:387 Species:Drosophila melanogaster


Alignment Length:145 Identity:42/145 - (28%)
Similarity:82/145 - (56%) Gaps:11/145 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 ELRDAFEKYDLDSNGTLSANEVRLALISVGYEITEAELYDLIHSVAVRDEERLDLKKFIRMMA-- 78
            |.|:||..:|.|.:|.::..|:...:.|:|......||.:::..:.|..:..:..::|:.:::  
  Fly   213 EFREAFRLFDKDGDGCITKEELGTVMRSLGQFARVEELQEMLQEIDVDGDGNVSFEEFVDILSNM 277

  Fly    79 -----PRMANVD-SDKSLCRTFNMIDRDRDGYVTVQDVRAIMVVLGEVVTDDDIKDICQAVDMDG 137
                 ..:::.| .::.|...|.:.|:...||:|..|:||::..|||.:.::||:|:.:.||:||
  Fly   278 TYEDKSGLSSADQEERELRDAFRVFDKHNRGYITASDLRAVLQCLGEDLDEEDIEDMIKEVDVDG 342

  Fly   138 DGRISLRDFVGFMHS 152
            ||||   ||..|:|:
  Fly   343 DGRI---DFYEFVHA 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13526NP_611714.1 PTZ00184 7..152 CDD:185504 41/143 (29%)
EFh 16..78 CDD:238008 14/61 (23%)
EFh 92..151 CDD:238008 25/58 (43%)
CG11638NP_569879.1 EFh 213..275 CDD:238008 14/61 (23%)
EF-hand_7 215..274 CDD:290234 13/58 (22%)
EFh 294..355 CDD:238008 27/64 (42%)
EF-hand_7 295..355 CDD:290234 27/63 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.