DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13526 and cam2

DIOPT Version :9

Sequence 1:NP_611714.1 Gene:CG13526 / 37613 FlyBaseID:FBgn0034774 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_594877.1 Gene:cam2 / 2542611 PomBaseID:SPAC29A4.05 Length:143 Species:Schizosaccharomyces pombe


Alignment Length:147 Identity:41/147 - (27%)
Similarity:76/147 - (51%) Gaps:10/147 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPSFSGNELTNEHIDELRDAFEKYDLDSNGTLSANEVRLALISVGYEITEAELYDLIHSVAVRDE 65
            ||:      :.|..||:::||..||:|.:|.:..:.|...|.|:|..:|:|||..|.:.:.    
pombe     1 MPA------SKEQTDEMKEAFVLYDIDKDGLIPTSHVGSVLRSLGINVTDAELAKLSNELG---- 55

  Fly    66 ERLDLKKFIRMMAPRMANVDSDKSLCRTFNMIDRDRDGYVTVQDVRAIMVVLGEVVTDDDIKDIC 130
            :.:|.|||:..::.::...:|::...:.|.:.|:|..||:........|..|||.::|::::.:.
pombe    56 DAIDEKKFMSFVSNKLRETESEEEYIKAFRVFDKDNSGYIETAKFADYMKTLGEKLSDNEVQLMV 120

  Fly   131 QAVDMDGDGRISLRDFV 147
            |..|....|.....|||
pombe   121 QEADPTNSGSFDYYDFV 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13526NP_611714.1 PTZ00184 7..152 CDD:185504 39/141 (28%)
EFh 16..78 CDD:238008 20/61 (33%)
EFh 92..151 CDD:238008 16/56 (29%)
cam2NP_594877.1 FRQ1 1..143 CDD:227455 41/147 (28%)
EFh 10..105 CDD:298682 26/98 (27%)
EFh 79..141 CDD:238008 16/59 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
22.060

Return to query results.
Submit another query.