DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13526 and CG30378

DIOPT Version :9

Sequence 1:NP_611714.1 Gene:CG13526 / 37613 FlyBaseID:FBgn0034774 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_724628.1 Gene:CG30378 / 246577 FlyBaseID:FBgn0050378 Length:148 Species:Drosophila melanogaster


Alignment Length:148 Identity:48/148 - (32%)
Similarity:87/148 - (58%) Gaps:1/148 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SGNELTNEHIDELRDAFEKYDLDSNGTLSANEVRLALISVGYEITEAELYDLIHSVAVRDEERLD 69
            ||: ||...|:|:|:||..||.:.:|.:|..::...:.::|..:||||:|||.:........::.
  Fly     2 SGS-LTEAQIEEIREAFSLYDKERSGWVSVQQLGGVMRALGESLTEAEIYDLANESNADFGGQVQ 65

  Fly    70 LKKFIRMMAPRMANVDSDKSLCRTFNMIDRDRDGYVTVQDVRAIMVVLGEVVTDDDIKDICQAVD 134
            .|.|:.:|:.|:...:|...|.:.|.:.||......|:.::|.:|..|||.::::|::::.|.:|
  Fly    66 FKDFLYVMSKRLEEQNSLVCLKQAFKIFDRSEVNSFTINEIRMVMTNLGEKMSEEDLRELFQDID 130

  Fly   135 MDGDGRISLRDFVGFMHS 152
            .|.||:||..:||..|.|
  Fly   131 QDKDGKISFNEFVTAMRS 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13526NP_611714.1 PTZ00184 7..152 CDD:185504 45/144 (31%)
EFh 16..78 CDD:238008 18/61 (30%)
EFh 92..151 CDD:238008 19/58 (33%)
CG30378NP_724628.1 PTZ00184 1..148 CDD:185504 47/146 (32%)
EFh 12..74 CDD:238008 18/61 (30%)
EFh 86..147 CDD:238008 20/60 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464474
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D607505at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.