DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13526 and cal-5

DIOPT Version :9

Sequence 1:NP_611714.1 Gene:CG13526 / 37613 FlyBaseID:FBgn0034774 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_508864.2 Gene:cal-5 / 192083 WormBaseID:WBGene00006861 Length:156 Species:Caenorhabditis elegans


Alignment Length:137 Identity:41/137 - (29%)
Similarity:74/137 - (54%) Gaps:6/137 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 DELRDAFEKYDLDSNGTLSANEVRLALISVGYEITEAELYDLIHSVAVRD-EERLDLKKFIRMMA 78
            |:|:..|.::||:.:|.:...|:|..:..:|...||.|| |.:...|.:| :..:|.::|:.:..
 Worm    21 DDLKGIFREFDLNGDGYIQREELRAVMQKMGQSPTEDEL-DAMFQAADKDCDGNIDFQEFLVIAK 84

  Fly    79 PRMANVDSDKSLCRTFNMIDRDRDGYVTVQDVRAIMVVLGEVVTDDDIKDICQAVDMDGDGRISL 143
            ....::    ||...|..:|.|.|||:|..::|.....:|..::|.|||.|.:.||.:.||:|:.
 Worm    85 ANPLSL----SLKAVFEELDVDGDGYITRSELRTAFQRMGHSLSDQDIKAIYRHVDQNNDGKINF 145

  Fly   144 RDFVGFM 150
            ::|...|
 Worm   146 QEFCEMM 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13526NP_611714.1 PTZ00184 7..152 CDD:185504 41/137 (30%)
EFh 16..78 CDD:238008 17/62 (27%)
EFh 92..151 CDD:238008 21/59 (36%)
cal-5NP_508864.2 PTZ00184 22..155 CDD:185504 40/136 (29%)
EFh 22..84 CDD:238008 17/62 (27%)
EFh 92..153 CDD:238008 22/61 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.