DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13526 and T09B4.4

DIOPT Version :9

Sequence 1:NP_611714.1 Gene:CG13526 / 37613 FlyBaseID:FBgn0034774 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_491778.2 Gene:T09B4.4 / 188316 WormBaseID:WBGene00020378 Length:142 Species:Caenorhabditis elegans


Alignment Length:131 Identity:27/131 - (20%)
Similarity:70/131 - (53%) Gaps:10/131 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 TNEHIDELRDAFEKYDLDSNGTL-SANEVRLALISVGYEIT--EAELYDLIHSVAVRDEERLDLK 71
            :.:.|||:|:.|..|  .::|.| :.:::|.||.|:||..|  :.::|     ....:::.::..
 Worm     6 SQKQIDEIRECFNFY--STSGVLRTDSQLRCALRSLGYSPTASKTDIY-----FKKLNKKPIEFA 63

  Fly    72 KFIRMMAPRMANVDSDKSLCRTFNMIDRDRDGYVTVQDVRAIMVVLGEVVTDDDIKDICQAVDMD 136
            .|:.:......:.:....:.:..:.:||::...:..:::.||:..:||.::.::||.:...|:::
 Worm    64 TFLDICKDEQNSPNPLTEIIKALSGLDRNKTRAMPSRELAAILSHVGEQMSPEEIKYLLSKVEVN 128

  Fly   137 G 137
            |
 Worm   129 G 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13526NP_611714.1 PTZ00184 7..152 CDD:185504 27/131 (21%)
EFh 16..78 CDD:238008 15/64 (23%)
EFh 92..151 CDD:238008 10/46 (22%)
T09B4.4NP_491778.2 PTZ00183 5..129 CDD:185503 26/129 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.