DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13526 and K03A1.4

DIOPT Version :9

Sequence 1:NP_611714.1 Gene:CG13526 / 37613 FlyBaseID:FBgn0034774 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_001041263.2 Gene:K03A1.4 / 186916 WormBaseID:WBGene00019352 Length:184 Species:Caenorhabditis elegans


Alignment Length:142 Identity:35/142 - (24%)
Similarity:70/142 - (49%) Gaps:13/142 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 IDELRDAFEKYDLDSNGTLSANEVRLALISVGYEITEAELYDLIHSVAVRDEERLDLKKFIRMM- 77
            |:|.:.||..:|.:::|.::.:|:..|:...|.:.|:.||..:::.........:...:|..:| 
 Worm    44 IEEYKRAFNFFDANNDGRITIDELEKAMQKCGQKPTKLELRLIMYHGDNDQNGVITFDEFAHLMN 108

  Fly    78 APRMANVDSDKSLCRTFNMIDRDRDGYVTVQDVRAIMVVLG-------EVVTDDDIKDICQAVDM 135
            .....|..:...|...|:|.|:|:||::...::.:|:..|.       :||     :.:....|:
 Worm   109 GTASMNQYTYDQLREQFDMFDKDKDGFIEKMEMLSIVRELSLQASFPRQVV-----EQLFNEADI 168

  Fly   136 DGDGRISLRDFV 147
            ||||:||..:||
 Worm   169 DGDGKISFEEFV 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13526NP_611714.1 PTZ00184 7..152 CDD:185504 35/142 (25%)
EFh 16..78 CDD:238008 13/62 (21%)
EFh 92..151 CDD:238008 19/63 (30%)
K03A1.4NP_001041263.2 PTZ00184 43..180 CDD:185504 33/140 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157752
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.