DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13526 and mlc-1

DIOPT Version :9

Sequence 1:NP_611714.1 Gene:CG13526 / 37613 FlyBaseID:FBgn0034774 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_510829.2 Gene:mlc-1 / 181776 WormBaseID:WBGene00003369 Length:170 Species:Caenorhabditis elegans


Alignment Length:151 Identity:28/151 - (18%)
Similarity:67/151 - (44%) Gaps:11/151 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SGNE---LTNEHIDELRDAFEKYDLDSNGTLSANEVRLALISVGYEITEAELYDLIHSVAVRDEE 66
            ||:|   ...:.|.|.::||...|.:.:|.:..::::....|:|....::::..:|...:    .
 Worm    14 SGSEAAQFDQKTIQEFKEAFGIMDQNKDGIIDKSDLKDLYASMGQIAPDSQIDAMIKEAS----G 74

  Fly    67 RLDLKKFIRMMAPRMANVDSDKSLCRTFNMIDRDRDGYVTVQD-VRAIMVVLGEVVTDDDIKDIC 130
            .::...|:.:...|:...|.:.::...|.|.|:...|.:...| ::.:....||.:.:|::|.:.
 Worm    75 PINFTVFLTLFGERLTGTDPEATIIGAFAMFDKKDCGKIKEDDLIKILQNKRGEPLDEDEVKAMY 139

  Fly   131 QAVDMDGDGRISLRDFVGFMH 151
            :.......|.:   |:..|.|
 Worm   140 KGKPPIEGGEV---DYKAFAH 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13526NP_611714.1 PTZ00184 7..152 CDD:185504 26/149 (17%)
EFh 16..78 CDD:238008 9/61 (15%)
EFh 92..151 CDD:238008 12/59 (20%)
mlc-1NP_510829.2 FRQ1 13..159 CDD:227455 28/151 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1435392at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.