DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13526 and Myl7

DIOPT Version :10

Sequence 1:NP_611714.1 Gene:CG13526 / 37613 FlyBaseID:FBgn0034774 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_075017.2 Gene:Myl7 / 17898 MGIID:107495 Length:175 Species:Mus musculus


Alignment Length:141 Identity:23/141 - (16%)
Similarity:58/141 - (41%) Gaps:23/141 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 IDELRDAFEKYDLDSNGTLSANEVRLALISVGYEITEAELYDLIHSVAVRDEE----------RL 68
            |.|.::||...|.:.:|.:..::::             |.|..:..|:|.:||          .:
Mouse    34 IQEFKEAFSCIDQNRDGIICKSDLK-------------ETYSQLGRVSVPEEELDAMLQEGKGPI 85

  Fly    69 DLKKFIRMMAPRMANVDSDKSLCRTFNMIDRDRDGYVTVQDVRAIMVVLGEVVTDDDIKDICQAV 133
            :...|:.:...::...|.::::...|.|.|....|.|..::.:.:::...:..:..:::.:....
Mouse    86 NFTVFLTLFGEKLNGTDPEEAILSAFRMFDPSGQGVVNKEEFKQLLMTQADKFSPAEVEQLFALT 150

  Fly   134 DMDGDGRISLR 144
            .||..|.|..:
Mouse   151 PMDLAGNIDYK 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13526NP_611714.1 PTZ00184 7..152 CDD:185504 23/141 (16%)
Myl7NP_075017.2 PTZ00184 28..168 CDD:185504 23/141 (16%)

Return to query results.
Submit another query.