DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13526 and cal-4

DIOPT Version :9

Sequence 1:NP_611714.1 Gene:CG13526 / 37613 FlyBaseID:FBgn0034774 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_001379504.1 Gene:cal-4 / 177945 WormBaseID:WBGene00000288 Length:236 Species:Caenorhabditis elegans


Alignment Length:149 Identity:49/149 - (32%)
Similarity:87/149 - (58%) Gaps:4/149 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 NELTNEHIDELRDAFEKYDLDSNGTLSANEVRLALISVGYEITEAELYDLIHSVAVRDEERLDLK 71
            :|.|.|.:.|...||:.:|.|.|.|::..|:..|:..:|...||.||.::::...|....::|..
 Worm    69 DEFTPEELQEFAQAFKLFDKDGNNTMNIKELGEAMRMLGLNPTEEELLNMVNEYDVDGNGKIDFG 133

  Fly    72 KFIRMMAPRMANVDSDKSLCR-TFNMIDRDRDGYVTVQDVRAIMVVLGEVVTDDDIKDICQAVDM 135
            :|.:||  :..|.::|:.|.| .|.:.|:|.:||:|.|:.:..|..:||..:::::.:|.:.||.
 Worm   134 EFCKMM--KEMNKETDQELIRLAFKVFDKDGNGYITAQEFKHFMTTMGERFSEEEVDEIIREVDK 196

  Fly   136 DGDGRISLRDFVGFMHSPI 154
            |||.:|.|.:||. |.:||
 Worm   197 DGDEQIDLDEFVN-MVAPI 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13526NP_611714.1 PTZ00184 7..152 CDD:185504 47/145 (32%)
EFh 16..78 CDD:238008 18/61 (30%)
EFh 92..151 CDD:238008 21/59 (36%)
cal-4NP_001379504.1 PTZ00184 68..211 CDD:185504 46/144 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.