DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13526 and tnc-2

DIOPT Version :9

Sequence 1:NP_611714.1 Gene:CG13526 / 37613 FlyBaseID:FBgn0034774 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_496251.1 Gene:tnc-2 / 174612 WormBaseID:WBGene00006583 Length:160 Species:Caenorhabditis elegans


Alignment Length:147 Identity:36/147 - (24%)
Similarity:76/147 - (51%) Gaps:4/147 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ELTNEHIDELRDAFEKYDLDSNGTLSANEVRLALISVGYEITEAELYDLIHSVAVRDEERLDLKK 72
            :|:.:.|::.|..|..:|.:..|.:.|.:|...|.::|....|.:|..||..........::.::
 Worm    11 KLSADQIEQFRKYFNMFDKEGKGYIRATQVGQILRTMGQAFEERDLKQLIKEFDADGSGEIEFEE 75

  Fly    73 FIRMMAPRMANVDSD----KSLCRTFNMIDRDRDGYVTVQDVRAIMVVLGEVVTDDDIKDICQAV 133
            |..|:|..:.|.::|    :.|...|.:.|::.:||:.|.|:|.|:..|.:.|:::::.::...:
 Worm    76 FAAMVANFVVNNENDEGLEEELREAFRLYDKEGNGYINVSDLRDILRALDDNVSEEELDEMIAEI 140

  Fly   134 DMDGDGRISLRDFVGFM 150
            |.||.|.:...:|:..|
 Worm   141 DADGSGTVDFDEFMEMM 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13526NP_611714.1 PTZ00184 7..152 CDD:185504 36/147 (24%)
EFh 16..78 CDD:238008 14/61 (23%)
EFh 92..151 CDD:238008 16/59 (27%)
tnc-2NP_496251.1 PTZ00184 10..157 CDD:185504 35/145 (24%)
EFh 19..81 CDD:238008 14/61 (23%)
EFh 96..158 CDD:238008 17/62 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.