DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13526 and CABP7

DIOPT Version :9

Sequence 1:NP_611714.1 Gene:CG13526 / 37613 FlyBaseID:FBgn0034774 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_872333.1 Gene:CABP7 / 164633 HGNCID:20834 Length:215 Species:Homo sapiens


Alignment Length:129 Identity:31/129 - (24%)
Similarity:70/129 - (54%) Gaps:11/129 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ELTNEHIDELRDAFEKYDLDSNGTLSANEVRLALISVGYEITEAELYDLIHSVAVRDEERLDLKK 72
            ::..:.::|:|:||:.:|.|.||.:|..|:..|:.|:||...|.||..:|..:.:..:.::|.::
Human    29 DIPEDELEEIREAFKVFDRDGNGFISKQELGTAMRSLGYMPNEVELEVIIQRLDMDGDGQVDFEE 93

  Fly    73 FIRMMAPRMANVDSDKSLCRTFNMIDRDRDGY------VTVQDVRAIMV-VLGEVVTDDDIKDI 129
            |:.::.|::    |...:...|:..|.|...:      :||.:::.::. ...|.::..||::|
Human    94 FVTLLGPKL----STSGIPEKFHGTDFDTVFWKCDMQKLTVDELKRLLYDTFCEHLSMKDIENI 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13526NP_611714.1 PTZ00184 7..152 CDD:185504 31/129 (24%)
EFh 16..78 CDD:238008 20/61 (33%)
EFh 92..151 CDD:238008 9/45 (20%)
CABP7NP_872333.1 PTZ00184 27..>102 CDD:185504 21/72 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.