DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13526 and EFCAB13

DIOPT Version :10

Sequence 1:NP_611714.1 Gene:CG13526 / 37613 FlyBaseID:FBgn0034774 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_689560.3 Gene:EFCAB13 / 124989 HGNCID:26864 Length:973 Species:Homo sapiens


Alignment Length:143 Identity:28/143 - (19%)
Similarity:63/143 - (44%) Gaps:19/143 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 IDELRDAFEKYDLDSNGTLSANEVRLALISVGYEITEAELYDLIHSVAVRDEERLDLKKFIRMM- 77
            ::|:::|........||.:...::..||..:...:||.:..:.::...|.|...:|||.|:..| 
Human   758 VNEIKEAANILSHVDNGKIGIPDLEHALKCLNVNLTEEDFNEALNCCNVSDNMEVDLKDFLMKMK 822

  Fly    78 -APRMANVDSDKSLCRTFNMIDRDRDGYVTVQDVRAIMVVLGEVVTDDDIKD-------ICQAVD 134
             :|......:.:.|..|..::..|   .|.|.|::.:::       |.|:..       :.:.|.
Human   823 ESPHFQKSKATQILLATTQILQND---LVDVSDLKTLLM-------DKDLHTANAILTVMLRHVP 877

  Fly   135 MDGDGRISLRDFV 147
            ....|::|:::|:
Human   878 EHESGKVSIQEFM 890

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13526NP_611714.1 PTZ00184 7..152 CDD:185504 28/143 (20%)
EFCAB13NP_689560.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 384..448
EF-hand_11 440..522 CDD:401068
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.