DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13526 and CETN2

DIOPT Version :9

Sequence 1:NP_611714.1 Gene:CG13526 / 37613 FlyBaseID:FBgn0034774 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_004335.1 Gene:CETN2 / 1069 HGNCID:1867 Length:172 Species:Homo sapiens


Alignment Length:143 Identity:39/143 - (27%)
Similarity:85/143 - (59%) Gaps:0/143 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ELTNEHIDELRDAFEKYDLDSNGTLSANEVRLALISVGYEITEAELYDLIHSVAVRDEERLDLKK 72
            |||.|...|:|:||:.:|.|..||:...|:::|:.::|:|..:.|:..:|..:......:::...
Human    24 ELTEEQKQEIREAFDLFDADGTGTIDVKELKVAMRALGFEPKKEEIKKMISEIDKEGTGKMNFGD 88

  Fly    73 FIRMMAPRMANVDSDKSLCRTFNMIDRDRDGYVTVQDVRAIMVVLGEVVTDDDIKDICQAVDMDG 137
            |:.:|..:|:..|:.:.:.:.|.:.|.|..|.::.::::.:...|||.:||::::::....|.||
Human    89 FLTVMTQKMSEKDTKEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDEELQEMIDEADRDG 153

  Fly   138 DGRISLRDFVGFM 150
            ||.:|.::|:..|
Human   154 DGEVSEQEFLRIM 166

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG13526NP_611714.1 PTZ00184 7..152 CDD:185504 39/143 (27%)
EFh 16..78 CDD:238008 15/61 (25%)
EFh 92..151 CDD:238008 17/59 (29%)
CETN2NP_004335.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30 4/5 (80%)