DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13526 and myl2

DIOPT Version :9

Sequence 1:NP_611714.1 Gene:CG13526 / 37613 FlyBaseID:FBgn0034774 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_001107717.1 Gene:myl2 / 100135705 XenbaseID:XB-GENE-482091 Length:167 Species:Xenopus tropicalis


Alignment Length:154 Identity:29/154 - (18%)
Similarity:66/154 - (42%) Gaps:25/154 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FSGNELTNEHIDELRDAFEKYDLDSNGTLSANEVRLALISVGYEITEAELYDLIHSVAVRDEERL 68
            ||..|.|  .|.|.::||...|.:.:|.:...::|....::|             .:.|::||..
 Frog    18 FSMFEQT--QIQEFKEAFTIMDQNRDGFIDKEDLRDTFAALG-------------RLNVKNEELE 67

  Fly    69 DLKK----------FIRMMAPRMANVDSDKSLCRTFNMIDRDRDGYVTVQDVRAIMVVLGEVVTD 123
            ::.|          |:.|...::...|.::::...|.:.|.:..|.:..:.:|.:::...|..|.
 Frog    68 EMLKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGTGLLKSEYIREMLMTQAERFTS 132

  Fly   124 DDIKDICQAVDMDGDGRISLRDFV 147
            :::..:..|...|..|.::.::.|
 Frog   133 EEVDQMFTAFPPDVTGNLNYKNLV 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13526NP_611714.1 PTZ00184 7..152 CDD:185504 27/151 (18%)
EFh 16..78 CDD:238008 13/71 (18%)
EFh 92..151 CDD:238008 10/56 (18%)
myl2NP_001107717.1 FRQ1 15..163 CDD:227455 29/154 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1435392at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.