DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp58d and Obp50e

DIOPT Version :9

Sequence 1:NP_611711.1 Gene:Obp58d / 37609 FlyBaseID:FBgn0034770 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_610959.2 Gene:Obp50e / 36600 FlyBaseID:FBgn0033931 Length:196 Species:Drosophila melanogaster


Alignment Length:232 Identity:51/232 - (21%)
Similarity:85/232 - (36%) Gaps:62/232 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IVCYWTFLILVAVSKAQDNEETTAVAISSGDLTEDKCNTSRAGCCSELYIGEEEDLVKCFVIHSP 68
            |:|:...||::..|.|..|      ..:..:......||    ||                 .:|
  Fly     5 IICFGFLLIILECSLASFN------CSAPPNFNNFDINT----CC-----------------RTP 42

  Fly    69 KLPVDGDADIGKTLRFLS---------------CFVECLYKQKKYI--GKSDTINMKMVKLDAEK 116
            :|.: ||.. .|..:::|               |:.:|:|::...:  ||   |.:..||...|:
  Fly    43 ELDM-GDVP-QKCHKYVSGLKSANSKYPSYAHLCYPDCIYRETGAMVNGK---IKVNRVKQYLEE 102

  Fly   117 TFVDRPKEKDYHIAM-FEFCRKDAVGVYNLLKASPGAKVLLKGACRPYLLMVFMCISDYHQKHEC 180
            ....|.:|...||.. ||.|..:..|....|... ..|||..| |.|:..:::.|: :......|
  Fly   103 HVHRRDQEIVSHIVQSFESCLSNVKGHMKSLNIE-SYKVLPHG-CSPFAGIIYSCV-NAETFLNC 164

  Fly   181 PYFRWEGTAKAGTKDMCENAK---AECYQIDGITLPT 214
            |...|:      .:..|..||   .:|..:..:.||:
  Fly   165 PQQMWK------NEKPCNLAKQFAEQCNPLPHVPLPS 195



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21066
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.