DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp58c and Obp93a

DIOPT Version :9

Sequence 1:NP_611710.1 Gene:Obp58c / 37608 FlyBaseID:FBgn0034769 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_650945.1 Gene:Obp93a / 42506 FlyBaseID:FBgn0038859 Length:196 Species:Drosophila melanogaster


Alignment Length:173 Identity:40/173 - (23%)
Similarity:75/173 - (43%) Gaps:27/173 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 ENTEAINEDHIHYCCKHPDGHNDLIEGCARETNFTLPNQNEEALVDITADRAIRGTCFGKCVFSK 88
            :|.:|||.     |.|...|:|.             .|.|.| :.::.:|:.....|..:|.| :
  Fly    42 KNDKAINS-----CRKSLLGNNS-------------TNSNGE-VRNLKSDKVALHACIAECSF-R 86

  Fly    89 LN--LMKDNNLDMDAVRSLFTERFPDDPEYAKEMINAFDHCHGKSEENTSMFLSKPLFKQMSKQF 151
            .|  |:.:..::..|::..:.:|:.:||..::.|:.:.:.|...:.:....|...|     .|..
  Fly    87 TNGFLLSNGTVNTQALQKSYQQRYKNDPNMSQLMLKSLNSCTDYARKRVQEFQWMP-----KKGD 146

  Fly   152 CDPKSSVVLACVIRQFFHNCPADRWSKTKECEDTLAFSKKCQD 194
            ||...:.:||||:.:.:.|||..:|..|.:|.....:...|.|
  Fly   147 CDFYPATLLACVMEKVYINCPTSKWKNTSDCTAMWKYLVACDD 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp58cNP_611710.1 PBP_GOBP 47..135 CDD:299791 15/89 (17%)
Obp93aNP_650945.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D116296at33392
OrthoFinder 1 1.000 - - FOG0014296
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21066
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.