DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp58c and Obp58b

DIOPT Version :9

Sequence 1:NP_611710.1 Gene:Obp58c / 37608 FlyBaseID:FBgn0034769 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_611709.1 Gene:Obp58b / 37607 FlyBaseID:FBgn0034768 Length:203 Species:Drosophila melanogaster


Alignment Length:199 Identity:103/199 - (51%)
Similarity:142/199 - (71%) Gaps:6/199 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CTIL-LSFFSLIWFAGGIKIDCENTEAINEDHIHYCCKHPDGHNDLIEGCARETNFTLPNQNEEA 66
            |.|: |....|:    .:::.|.:.|.|:|::||:||||.|||:|:.|.||::|||.||:.||||
  Fly     9 CVIISLRLNGLV----AVRVHCRHMERIHEENIHHCCKHQDGHDDVTESCAKQTNFRLPSPNEEA 69

  Fly    67 LVDITADRAIRGTCFGKCVFSKLNLMKDNNLDMDAVRSLFTERFPDDPEYAKEMINAFDHCHGKS 131
            :||:|.|:|:.|||:.||||...|||::|.||||.|||.:......|||||.||:||::.||.:|
  Fly    70 IVDVTVDQAMVGTCWAKCVFDHYNLMENNTLDMDKVRSYYKRYHQTDPEYATEMLNAYEKCHTQS 134

  Fly   132 EENTSMFLSKPLFKQMS-KQFCDPKSSVVLACVIRQFFHNCPADRWSKTKECEDTLAFSKKCQDS 195
            ||.|..|||.|:.:..| .:||.|.||::::|||..|||||||.|||.|.||.:||||::||:|.
  Fly   135 EEATEKFLSLPIVRAFSTAKFCKPTSSIIMSCVIYNFFHNCPASRWSNTTECVETLAFARKCKDV 199

  Fly   196 LATL 199
            |.|:
  Fly   200 LTTM 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp58cNP_611710.1 PBP_GOBP 47..135 CDD:299791 49/87 (56%)
Obp58bNP_611709.1 PBP_GOBP 52..154 CDD:299791 55/101 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472871
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 64 1.000 Inparanoid score I7590
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D116296at33392
OrthoFinder 1 1.000 - - FOG0014296
OrthoInspector 1 1.000 - - mtm9723
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21066
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
77.000

Return to query results.
Submit another query.