DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp58c and Obp47b

DIOPT Version :9

Sequence 1:NP_611710.1 Gene:Obp58c / 37608 FlyBaseID:FBgn0034769 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_610669.1 Gene:Obp47b / 36207 FlyBaseID:FBgn0033614 Length:199 Species:Drosophila melanogaster


Alignment Length:183 Identity:49/183 - (26%)
Similarity:82/183 - (44%) Gaps:16/183 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 GGIKIDCENTEAINEDHIHYCCKHPDGHNDLI-EGCARETNFTLPNQNEEALVDITADRAIRGTC 80
            |...|||:....:.:..:  |||  ||..|.: |.||:....|...|  :|....:.|.|   .|
  Fly    22 GQATIDCQRPPQLVDPAL--CCK--DGGRDQVAEQCAQRILGTANGQ--KAGGPPSLDTA---AC 77

  Fly    81 FGKCVFSKLNLMKD-NNLDMDAVRSLFTERFPDDPEYAKEMINAFDHCHGKSEENTSMFLSKPLF 144
            ..:|:.:....:.: ..|::..:||..:.:|.:|..|.:.|..||..|..:|:...:|.:.:...
  Fly    78 LAECILTSSKYIDEPQKLNLANIRSDLSAKFSNDTLYVETMTMAFSKCEPQSQRRLAMIMQQQQQ 142

  Fly   145 KQMSK-----QFCDPKSSVVLACVIRQFFHNCPADRWSKTKECEDTLAFSKKC 192
            .|..|     ..|.|.|::||.|...::|.|||..||:...:|....|:..:|
  Fly   143 VQQQKTQQQQPRCSPFSAIVLGCTYMEYFKNCPDHRWTPNAQCTLAKAYVTQC 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp58cNP_611710.1 PBP_GOBP 47..135 CDD:299791 21/89 (24%)
Obp47bNP_610669.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472875
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.