DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp58c and Obp46a

DIOPT Version :9

Sequence 1:NP_611710.1 Gene:Obp58c / 37608 FlyBaseID:FBgn0034769 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_610574.1 Gene:Obp46a / 36088 FlyBaseID:FBgn0033508 Length:198 Species:Drosophila melanogaster


Alignment Length:213 Identity:51/213 - (23%)
Similarity:93/213 - (43%) Gaps:39/213 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CTILLSFFSLIW--FAGG------IKIDCENTEAINE-DHIH-YCCKHPDGHND--LIEGCARET 55
            |:.|.:|..|:.  |..|      :..|||    :|. |.:| :||   |.|::  ....|..|.
  Fly     2 CSQLFAFLLLLLTAFVTGRSTPPALDEDCE----LNSVDTMHDFCC---DLHDESPQFSDCQMEW 59

  Fly    56 NFTLPNQNEEALVDITADRAIRGTCFGKCVFSKLNLM-KD-NNLDMDAVRSLFTERFPDDPEYAK 118
            :..:|.:.:|       :......|..:|.|:..|.: :| .:|:::.|:........:|.: .|
  Fly    60 HEKIPYETDE-------EEQTYMFCTAECSFNSTNFLGRDRRSLNLNEVKEHLESDLVNDAD-IK 116

  Fly   119 EMINAFDHCHGKSEENTSMFLS-----KPLFKQMSKQFCDPKSSVVLACVIRQFFHNCPADRWSK 178
            .:.:.:..|     :..::.|.     |.|.|::|:..|.|...:||.||..:...:||..|:.:
  Fly   117 LLYDTYVKC-----DKHALSLMPHKGVKQLSKRLSRLGCHPYPGLVLECVANEMILHCPTKRFRQ 176

  Fly   179 TKECEDTLAFSKKCQDSL 196
            |.:||:|....|:|...|
  Fly   177 TAQCEETRNHLKQCMQYL 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp58cNP_611710.1 PBP_GOBP 47..135 CDD:299791 14/89 (16%)
Obp46aNP_610574.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472872
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0014296
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21066
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.