DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp58b and Obp59a

DIOPT Version :9

Sequence 1:NP_611709.1 Gene:Obp58b / 37607 FlyBaseID:FBgn0034768 Length:203 Species:Drosophila melanogaster
Sequence 2:NP_788429.1 Gene:Obp59a / 37605 FlyBaseID:FBgn0034766 Length:202 Species:Drosophila melanogaster


Alignment Length:235 Identity:40/235 - (17%)
Similarity:70/235 - (29%) Gaps:89/235 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VICVIISLRLNGLVAVRVHCRHMERIHE----ENIHHCCKHQD---------------------- 45
            :|.::|.|.........:.||..|.:.|    ..:.:|...||                      
  Fly     4 LIFLLICLSCGTCSIYALKCRSQEGLSEAELKRTVRNCMHRQDEDEDRGRGGQGRQGNGYEYGYG 68

  Fly    46 ----------------GHDDVTESCAKQTNFRLPSPNEEAIVDVTVDQAMVGTCWAKCVFDHYNL 94
                            |:.:..:...:|::.|..:.|:.            |.|.|:|.|:..|:
  Fly    69 MDHDQEEQDRNPGNRGGYGNRRQRGLRQSDGRNHTSNDG------------GQCVAQCFFEEMNM 121

  Fly    95 MENNTL-DMDKVRSYYKRYHQTDPEYATEMLNAYEKCHTQSEEATEKFLSLPIVRAFSTAKFCKP 158
            ::.|.: |..|| ||.......|.|......:..::|....|               |..:    
  Fly   122 VDGNGMPDRRKV-SYLLTKDLRDRELRNFFTDTVQQCFRYLE---------------SNGR---- 166

  Fly   159 TSSIIMSCVIYNFFHNCPASRWSNTTECVETLAFARKCKD 198
                       ...|.|.|:|  ...:|:...|.| :|:|
  Fly   167 -----------GRHHKCSAAR--ELVKCMSEYAKA-QCED 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp58bNP_611709.1 PBP_GOBP 52..154 CDD:299791 20/102 (20%)
Obp59aNP_788429.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21066
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.