DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp58b and Obp46a

DIOPT Version :9

Sequence 1:NP_611709.1 Gene:Obp58b / 37607 FlyBaseID:FBgn0034768 Length:203 Species:Drosophila melanogaster
Sequence 2:NP_610574.1 Gene:Obp46a / 36088 FlyBaseID:FBgn0033508 Length:198 Species:Drosophila melanogaster


Alignment Length:185 Identity:35/185 - (18%)
Similarity:76/185 - (41%) Gaps:38/185 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 MERIHEENIHHCCKHQDGHDDVTE--SCAKQTNFRLPSPNEEAIVDVTVDQAMVGTCWAKCVFDH 91
            ::.:|:    .||   |.||:..:  .|..:.:.::|...:|       ::.....|.|:|.|:.
  Fly    35 VDTMHD----FCC---DLHDESPQFSDCQMEWHEKIPYETDE-------EEQTYMFCTAECSFNS 85

  Fly    92 YNLM--ENNTLDMDKVRSYYKRYHQTDPEYATEMLNAYEKC---------HTQSEEATEKFLSLP 145
            .|.:  :..:|::::|:.:.:.....|.:... :.:.|.||         |...::.:::...|.
  Fly    86 TNFLGRDRRSLNLNEVKEHLESDLVNDADIKL-LYDTYVKCDKHALSLMPHKGVKQLSKRLSRLG 149

  Fly   146 IVRAFSTAKFCKPTSSIIMSCVIYNFFHNCPASRWSNTTECVETLAFARKCKDVL 200
                      |.|...:::.||......:||..|:..|.:|.||....::|...|
  Fly   150 ----------CHPYPGLVLECVANEMILHCPTKRFRQTAQCEETRNHLKQCMQYL 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp58bNP_611709.1 PBP_GOBP 52..154 CDD:299791 16/114 (14%)
Obp46aNP_610574.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472873
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0014296
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21066
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.