DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp58b and Obp73a

DIOPT Version :10

Sequence 1:NP_611709.1 Gene:Obp58b / 37607 FlyBaseID:FBgn0034768 Length:203 Species:Drosophila melanogaster
Sequence 2:NP_001097628.1 Gene:Obp73a / 2768955 FlyBaseID:FBgn0036681 Length:259 Species:Drosophila melanogaster


Alignment Length:45 Identity:11/45 - (24%)
Similarity:19/45 - (42%) Gaps:4/45 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 VTVDQAMVGTCWAKCVFDHYNLMENN---TLDMDKVRSYYKRYHQ 114
            |.::...:..|...||:...|.::..   ||| ..|..|.:..|:
  Fly   143 VPLEDKRIAGCLLHCVYAKNNAIDQRGWPTLD-GLVHFYSEGVHE 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp58bNP_611709.1 PBP_GOBP 52..154 CDD:472229 11/45 (24%)
Obp73aNP_001097628.1 None

Return to query results.
Submit another query.