DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30259 and CG10958

DIOPT Version :9

Sequence 1:NP_611708.2 Gene:CG30259 / 37606 FlyBaseID:FBgn0050259 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_572445.1 Gene:CG10958 / 31736 FlyBaseID:FBgn0030004 Length:743 Species:Drosophila melanogaster


Alignment Length:370 Identity:66/370 - (17%)
Similarity:132/370 - (35%) Gaps:73/370 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 NKLANMSEEERARYLQMRADMEEETRRRKMQLISMYMKN----KLKREDAFGRLNMAKINQEWRS 70
            |:|....:|     |.....:..|.|....:|.....||    ||:||..........|...|..
  Fly   104 NELVRFGKE-----LVTNVRVANERRELNRRLFEGAQKNQMHVKLQRESVETMARFENIKARWTE 163

  Fly    71 I-------LRQVKIQELRREIVDVESFFQEALKRKDQVIHRLIAHIESTEDMYANLQQSHMENIT 128
            :       |...:|:|.::.|.::       :.|||::|....|.::.....|...::...:::.
  Fly   164 LEETNEPMLLWDQIEEQKKRIAEI-------MARKDEMISACQAEVDRMNAKYEFDRERQAQDLC 221

  Fly   129 RIV-----------DTHRDRIEFFRTIYEDDKQA----VLSQWEQDSAAFKEMHAQKQQQLECV- 177
            .:|           :.:::.|:..|...|:::|.    .:.:|.   ..|..|:|...::...| 
  Fly   222 CLVERVDHQVETLKEAYKEHIQMLRQTIEEERQIFADNAVEKWR---TFFDAMNANFDEKANLVR 283

  Fly   178 ----FY-----QLEENTDGGIRDNHERFLDRCEDLKSGMQLQLEQITSRGEARLEKLWQEYQGVL 233
                ||     |:.|:.:...:....|....||.|    :|:|.:.........|||...||   
  Fly   284 AREQFYARQTQQINESQEELTKSTRIRLEKECERL----ELELRRTRDNVLMNSEKLDYNYQ--- 341

  Fly   234 AGYCQHIEGFYSEYVDLKQRDEEAALQISQQTHEIEHLVDQLTNLRLVSEEFYIKQQGQLEQRQA 298
                           .|::|:||..:..:||...:..|.:.:...|...:..|...:..:.:..:
  Fly   342 ---------------VLQKRNEENVIINNQQKRRVARLHEAIGRTRRGLKNLYNTGKRNIARLSS 391

  Fly   299 IKQQLTERLRELRTCVEQEVARDHQLFKLMSVESYHALEFLQETV 343
            ...:|...:.::.:...|....:.:.|..:...:|..|..|.:.|
  Fly   392 DIYKLHSNINDMESKAHQARLNNREKFDRIWEINYKELNLLVDRV 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30259NP_611708.2 NYD-SP28 27..127 CDD:291438 21/110 (19%)
CG10958NP_572445.1 NYD-SP28 120..220 CDD:291438 21/106 (20%)
NYD-SP28_assoc 684..741 CDD:291441
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450088
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21625
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.