DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment robo1 and NECTIN4

DIOPT Version :9

Sequence 1:NP_476899.1 Gene:robo1 / 37603 FlyBaseID:FBgn0005631 Length:1395 Species:Drosophila melanogaster
Sequence 2:XP_011508323.1 Gene:NECTIN4 / 81607 HGNCID:19688 Length:511 Species:Homo sapiens


Alignment Length:440 Identity:103/440 - (23%)
Similarity:152/440 - (34%) Gaps:142/440 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 SRSSRMWLLPAWLLLVLVASN---GLPAVRGQYQSPRIIEHPTDLVVKKNEPATLNCKVEGKPEP 85
            |..:.||...|||||:|:.::   ..||  |:.::..::      .|...:.|.|.|        
Human     4 SLGAEMWGPEAWLLLLLLLASFTGRCPA--GELETSDVV------TVVLGQDAKLPC-------- 52

  Fly    86 TIEWFKDGEPVSTNEKKSHRVQFKDGALFFYRTMQGKKEQDGGEYWCVAKNRVGQAVSRHASLQI 150
                                         |||...|  ||.|...|  |:...|:...     ::
Human    53 -----------------------------FYRGDSG--EQVGQVAW--ARVDAGEGAQ-----EL 79

  Fly   151 AVLRDDF--RVEPK-DTRVAKGETALLECGPPKGIPEPTLIWIKDGVPLDDLKAMSFGASSRVRI 212
            |:|...:  .|.|. :.||.:..       ||:.             |||               
Human    80 ALLHSKYGLHVSPAYEGRVEQPP-------PPRN-------------PLD--------------- 109

  Fly   213 VDGGNLLISNVEPIDEGNYKCIAQNLVGTRESSYAKLIVQVKPYFMKEP-----KDQVMLYGQTA 272
               |::|:.|....|||.|:|...........:..:|.|.|.|.....|     :.|    |.|.
Human   110 ---GSVLLRNAVQADEGEYECRVSTFPAGSFQARLRLRVLVPPLPSLNPGPALEEGQ----GLTL 167

  Fly   273 TFHCSVGGDPPPKVLWKKEEGNIPVSRARILHDEKSLEIS--NITPT---DEGTYVC-EAHNNVG 331
            ...|:..|.|.|.|.|..|......||: ..|...:...|  ::.|:   :.....| .:|..:.
Human   168 AASCTAEGSPAPSVTWDTEVKGTTSSRS-FKHSRSAAVTSEFHLVPSRSMNGQPLTCVVSHPGLL 231

  Fly   332 QISARASLIVHAPPNFTKRPSNK--------KVGLNGVVQLPCMASGNPPPSVFWTK-EGVSTLM 387
            | ..|.:.|:|.  :|....|.:        .:|..|.: |.|::.|.||||..||: :|    .
Human   232 Q-DQRITHILHV--SFLAEASVRGLEDQNLWHIGREGAM-LKCLSEGQPPPSYNWTRLDG----P 288

  Fly   388 FPNSSHGRQHVAADG-TLQITDVRQEDEGYYVC---SAFSVVDSS-TVRV 432
            .|:.      |..|| ||....:..|..|.|||   :.||..||. ||.|
Human   289 LPSG------VRVDGDTLGFPPLTTEHSGIYVCHVSNEFSSRDSQVTVDV 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
robo1NP_476899.1 Ig 56..151 CDD:299845 14/94 (15%)
I-set 56..150 CDD:254352 14/93 (15%)
I-set 157..251 CDD:254352 18/96 (19%)
Ig2_Robo 159..251 CDD:143201 18/92 (20%)
I-set 255..341 CDD:254352 21/96 (22%)
Ig3_Robo 272..341 CDD:143202 16/74 (22%)
IG_like 351..436 CDD:214653 31/96 (32%)
Ig 362..444 CDD:299845 28/77 (36%)
I-set 445..531 CDD:254352
IGc2 459..521 CDD:197706
FN3 549..637 CDD:238020
FN3 673..762 CDD:238020
fn3 770..855 CDD:278470
NECTIN4XP_011508323.1 IG_like 37..145 CDD:214653 34/197 (17%)
Ig1_Nectin-4_like 46..146 CDD:143296 33/183 (18%)
Ig2_Nectin-3-4_like 149..242 CDD:143328 22/98 (22%)
IG_like 259..332 CDD:214653 29/83 (35%)
IGc2 268..320 CDD:197706 21/61 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.