DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment robo1 and nectin3a

DIOPT Version :9

Sequence 1:NP_476899.1 Gene:robo1 / 37603 FlyBaseID:FBgn0005631 Length:1395 Species:Drosophila melanogaster
Sequence 2:XP_017206634.2 Gene:nectin3a / 793240 ZFINID:ZDB-GENE-130530-670 Length:550 Species:Danio rerio


Alignment Length:373 Identity:77/373 - (20%)
Similarity:126/373 - (33%) Gaps:95/373 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 LLPAWLLLVLVASNGLPAVRGQYQSPRIIEHPTDLVVKKNEPATLNCKVEGKPEPTI---EW--- 89
            |||   ||..:.|    |..|.:.:..::......|:.||  .||:|::|.....::   .|   
Zfish    18 LLP---LLGFLFS----ACDGVWSNQVVVPAQVTSVLGKN--VTLSCRMEMSSNLSLTQSSWERH 73

  Fly    90 ----------FKDGEPVSTNEKKSHRVQF-KDGALFFYRTMQGKKEQDGGEYWCVAKNRVGQAVS 143
                      |......|..::.|.||.| |.........:||....|.|.|.|  |....:..:
Zfish    74 LPSGIITLAVFNPVYGTSVADEYSRRVHFLKPSVHDVSIVLQGVGFADIGMYTC--KMVTFELGN 136

  Fly   144 RHASLQIAVLRDDFRVEPK--------DTRVAKGETALLECGPPKGIPEPTLIWIKDGVPLDDLK 200
            ..||..:     |..||||        ......|||.:..|...:|.|...:.|..|        
Zfish   137 MQASTNV-----DVMVEPKVYVSPGSLSLTADDGETLVATCTAERGRPAAEVFWESD-------- 188

  Fly   201 AMSFGASSRVRIVDGGNLLISNVEPIDEGNYKCIAQNLVGTRESSYAKLI--------------- 250
                        :.|...:::..||  ||....:...::....:|:.:.:               
Zfish   189 ------------LPGQTAVVTQSEP--EGTTTTLVHYVLAPTRASHGRSLSCVVRHPALSRDFRI 239

  Fly   251 -VQVKPYFMKEPKDQVMLYG---------QTATFHCSVGGDPPPK-VLWKKEEGNIPVSRARILH 304
             .::..:|:.:    ||:.|         :.....|....:||.. .||.:.:..:|....  :|
Zfish   240 PYRLNVFFVPD----VMVIGGKNVWYVGQKDVQLDCKANANPPALFYLWTRLDALMPAGVN--MH 298

  Fly   305 DEKSLEISNITPTDEGTYVCEAHNNVGQISARASLIVHAPPNFTKRPS 352
            :...:....:..||.|.|.||..|:|||.......:|..||..|..|:
Zfish   299 NGSLVFTRPLEATDSGQYRCEVQNDVGQNFHDVPFLVLDPPPTTAAPT 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
robo1NP_476899.1 Ig 56..151 CDD:299845 24/111 (22%)
I-set 56..150 CDD:254352 24/110 (22%)
I-set 157..251 CDD:254352 18/117 (15%)
Ig2_Robo 159..251 CDD:143201 18/115 (16%)
I-set 255..341 CDD:254352 21/95 (22%)
Ig3_Robo 272..341 CDD:143202 17/69 (25%)
IG_like 351..436 CDD:214653 1/2 (50%)
Ig 362..444 CDD:299845
I-set 445..531 CDD:254352
IGc2 459..521 CDD:197706
FN3 549..637 CDD:238020
FN3 673..762 CDD:238020
fn3 770..855 CDD:278470
nectin3aXP_017206634.2 Ig 49..146 CDD:325142 24/105 (23%)
Ig 149..245 CDD:325142 16/117 (14%)
Ig 264..325 CDD:325142 14/62 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.