DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment robo1 and htra1

DIOPT Version :9

Sequence 1:NP_476899.1 Gene:robo1 / 37603 FlyBaseID:FBgn0005631 Length:1395 Species:Drosophila melanogaster
Sequence 2:NP_001072730.2 Gene:htra1 / 780187 XenbaseID:XB-GENE-487699 Length:460 Species:Xenopus tropicalis


Alignment Length:256 Identity:51/256 - (19%)
Similarity:83/256 - (32%) Gaps:74/256 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   537 TSLHR----AADPSTYPAPPGTPKVLNV-SRTSISLRWAKSQEKPGAVGPIIGYTVEYFSPDLQT 596
            |:.||    .:|.|||.|     ::::| .:..|:|...|::.|...:  ::|.     |.||:.
 Frog   202 TNKHRLKVERSDGSTYDA-----QIIDVDEKADIALIKIKAKGKLPVL--LLGR-----SEDLRP 254

  Fly   597 GWIVAAQRVGDTQVTISGLTPGTSYVFLVRAENTQGISVPSGLSNTIKTIEADFDAASANDLSAA 661
            |..|.|                              |..|..|.||:.|...........:|.  
 Frog   255 GEFVVA------------------------------IGSPFSLQNTVTTGIVSTAQRGGKELG-- 287

  Fly   662 RTLLTGKSVELIDASAI------NASAVRLEWMLHVSADEKYVEGLRIHYKDASVPSAQYHSITV 720
               |....::.|...||      ....|.|:..:......|...|:..     ::||.:......
 Frog   288 ---LRNSDMDYIQTDAIINYGNSGGPLVNLDGEVIGINTLKVTAGISF-----AIPSDKIRKFLA 344

  Fly   721 MDASAESFVVGNLKKYTKY---------EFFLTPFFETIEGQPSNSKTALTYEDVPSAPPD 772
            ...:.:|...|..||  ||         :..|....|.::..|.|:..|...|.:|..|.:
 Frog   345 ESHNRQSTGQGTKKK--KYLGIRMMSLSQGKLKELKEQVKDFPENTSGAYIVEVIPDTPAE 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
robo1NP_476899.1 Ig 56..151 CDD:299845
I-set 56..150 CDD:254352
I-set 157..251 CDD:254352
Ig2_Robo 159..251 CDD:143201
I-set 255..341 CDD:254352
Ig3_Robo 272..341 CDD:143202
IG_like 351..436 CDD:214653
Ig 362..444 CDD:299845
I-set 445..531 CDD:254352
IGc2 459..521 CDD:197706
FN3 549..637 CDD:238020 14/88 (16%)
FN3 673..762 CDD:238020 20/103 (19%)
fn3 770..855 CDD:278470 1/3 (33%)
htra1NP_001072730.2 IGFBP 26..80 CDD:365955
KAZAL 89..>115 CDD:197624
degP_htrA_DO 151..>459 CDD:273938 51/256 (20%)
Serine protease 183..343 37/192 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.