DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment robo1 and DIP-epsilon

DIOPT Version :9

Sequence 1:NP_476899.1 Gene:robo1 / 37603 FlyBaseID:FBgn0005631 Length:1395 Species:Drosophila melanogaster
Sequence 2:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster


Alignment Length:363 Identity:93/363 - (25%)
Similarity:138/363 - (38%) Gaps:63/363 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 LLISNVEPIDEGNYKCIAQNLVGTRESSYAKLIVQVKPYFMKEPKDQVMLYGQTATFHCSVGGDP 282
            |.|:||:..|.|.|.|....:....:..:.|::|...........|.::..|...|..|...|.|
  Fly   122 LHINNVQEEDRGRYMCQINTVTAKTQYGFVKVVV
PPNIDDALTSSDIIVREGDNVTLRCKAKGSP 186

  Fly   283 PPKVLWKKEEGN-IPVSRARILHD--EKSLEISNITPTDEGTYVCEAHNNVG-------QISARA 337
            .|.:.||:::|| |.:::...:||  ..|||:..|:....|.|:|.|.|.|.       ::|...
  Fly   187 EPTIKWKRDDGNKIVINKTLEVHDLETDSLELERISRLHMGAYLCIASNGVPPSVSKRIKVSVDF 251

  Fly   338 SLIVHAPPNFTKRPSNKKVGLNGVVQLPCMASGNPPPSVFWTKEGVSTLMFPNSSH-------GR 395
            |.:|..|......|    :|.|  :.|.|....||....:||:|  :..|...||.       |.
  Fly   252 SPMVWIPHQLVGIP----IGFN--ITLECFIEANPTSLNYWTRE--NDQMITESSKYKTETIPGH 308

  Fly   396 QHVAADGTLQITDVRQEDEGYYVCSAFSVVDSSTVRVFLQVSSLDERPPPIIQIGPANQTLPKGS 460
            ....|...|.||:|:..|.|.|.|.|.:........:.|.:||     ||..|..|...||    
  Fly   309 PSYKATMRLTITNVQSSDYGNYKCVAKNPRGDMDGNIKLYMSS-----PPTTQPPPTTTTL---- 364

  Fly   461 VATLPCRATGNPSPRIKWFHDGH-----------AVQAGNRYSIIQG--SSLR-VDDLQLSDSGT 511
                  |.|...:..|..  ||:           .|..|...|:|..  ||:: :.:|...|...
  Fly   365 ------RRTTTTAAEIAL--DGYINTPLNGNGIGIVGEGPTNSVIASGKSSIKYLSNLNEIDKSK 421

  Fly   512 YTCTASGERGETSWAATLTVEKPGSTSLHRAADPSTYP 549
            ...|.|..:| ..|:      |..|:..|.....|::|
  Fly   422 QKLTGSSPKG-FDWS------KGKSSGSHGNLMASSWP 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
robo1NP_476899.1 Ig 56..151 CDD:299845
I-set 56..150 CDD:254352
I-set 157..251 CDD:254352 9/32 (28%)
Ig2_Robo 159..251 CDD:143201 9/32 (28%)
I-set 255..341 CDD:254352 26/95 (27%)
Ig3_Robo 272..341 CDD:143202 24/78 (31%)
IG_like 351..436 CDD:214653 25/91 (27%)
Ig 362..444 CDD:299845 24/88 (27%)
I-set 445..531 CDD:254352 22/99 (22%)
IGc2 459..521 CDD:197706 15/75 (20%)
FN3 549..637 CDD:238020 1/1 (100%)
FN3 673..762 CDD:238020
fn3 770..855 CDD:278470
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 9/32 (28%)
Ig 69..139 CDD:143165 8/16 (50%)
IG_like 165..249 CDD:214653 24/83 (29%)
IGc2 172..237 CDD:197706 22/64 (34%)
IG_like 267..348 CDD:214653 23/84 (27%)
Ig 270..339 CDD:299845 21/70 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12231
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.