DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment robo1 and Jam2

DIOPT Version :9

Sequence 1:NP_476899.1 Gene:robo1 / 37603 FlyBaseID:FBgn0005631 Length:1395 Species:Drosophila melanogaster
Sequence 2:NP_001029176.1 Gene:Jam2 / 619374 RGDID:1561692 Length:298 Species:Rattus norvegicus


Alignment Length:283 Identity:73/283 - (25%)
Similarity:103/283 - (36%) Gaps:64/283 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 PAWLLLVLV-----------ASNGLPAVRGQYQSPRIIEHPTDLVVKKNEPATLNCKVEGKPEPT 86
            |..|||:|:           .:||..|.:...|...:||:         :.|.|.||...|...:
  Rat     5 PQGLLLLLLLHYLMVALDYHKANGFSASKDHRQEVSVIEY---------QEAILACKTPKKTTSS 60

  Fly    87 -IEWFKDGEPVS-TNEKKSHRVQFKDGA--LFFYRTMQGKKEQDGGEYWCVAKNRVGQAVSRHAS 147
             :||.|.|:.|| ...:::.:..|||.|  :.|...::.....|.|||.|    .|.....:..:
  Rat    61 RLEWKKLGQGVSLVYYQQALQGDFKDRAEMIDFNIRIKNVTRHDAGEYRC----EVSAPTEQGQN 121

  Fly   148 LQIAVLRDDFRVEPK------DTRVAKGETALLECGPPKGIPEPTLIWIKDGVP-LDDLKAMSFG 205
            ||...:..:..|.|.      .|.|..|....|.|...:|.|.|..||.|||.. |.:.|..:..
  Rat   122 LQEDTVMLEVLVAPAVPSCEVPTSVMSGSVVELRCQEKEGNPAPEYIWFKDGTSLLGNPKGGAHR 186

  Fly   206 ASSRVRIVDGGNLLISNVEPIDEGNYKCIAQNLVGTRESSYAKLIVQV----------------- 253
            .||.......|.|..:.:..:|.|.|.|.|:|.||.|.....::.|.|                 
  Rat   187 NSSYTMNTKSGTLQFNMISKMDSGEYYCEARNSVGHRRCPGKRMQVDVLNISGIIAAVVVVAFVI 251

  Fly   254 ------------KPYFMKEPKDQ 264
                        |.||.||...|
  Rat   252 SACGLSICYAQRKGYFSKETSFQ 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
robo1NP_476899.1 Ig 56..151 CDD:299845 26/98 (27%)
I-set 56..150 CDD:254352 25/97 (26%)
I-set 157..251 CDD:254352 30/100 (30%)
Ig2_Robo 159..251 CDD:143201 30/98 (31%)
I-set 255..341 CDD:254352 5/10 (50%)
Ig3_Robo 272..341 CDD:143202
IG_like 351..436 CDD:214653
Ig 362..444 CDD:299845
I-set 445..531 CDD:254352
IGc2 459..521 CDD:197706
FN3 549..637 CDD:238020
FN3 673..762 CDD:238020
fn3 770..855 CDD:278470
Jam2NP_001029176.1 IG_like 37..131 CDD:214653 27/106 (25%)
Ig 47..113 CDD:143165 21/69 (30%)
IG_like 143..221 CDD:214653 25/77 (32%)
IGc2 148..221 CDD:197706 23/72 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.