DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment robo1 and NECTIN1

DIOPT Version :9

Sequence 1:NP_476899.1 Gene:robo1 / 37603 FlyBaseID:FBgn0005631 Length:1395 Species:Drosophila melanogaster
Sequence 2:NP_002846.3 Gene:NECTIN1 / 5818 HGNCID:9706 Length:517 Species:Homo sapiens


Alignment Length:370 Identity:81/370 - (21%)
Similarity:130/370 - (35%) Gaps:108/370 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   249 LIVQVKPYFMKEPKDQVM-----LYGQTAT---FHCSVGGDPP----PKVLWKK----EEGNIPV 297
            |.:.:..:|:.....||:     :||...|   .|||.....|    .:|.|:|    .:.|:.:
Human    16 LALGLTAFFLPGVHSQVVQVNDSMYGFIGTDVVLHCSFANPLPSVKITQVTWQKSTNGSKQNVAI 80

  Fly   298 --------------SRARILH---DEKSLEISNITPTDEGTYVCE-AHNNVGQISARASLIVHA- 343
                          .|...|.   .:.::.:|.:...|||.|:|| |....|...::.:|.|.| 
Human    81 YNPSMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELEDEGVYICEFATFPTGNRESQLNLTVMAK 145

  Fly   344 PPNF---------TKRPSNKKVGLNGVVQLPCMASGNPPPSVFWTKEGVSTLMFPNSSHGRQHVA 399
            |.|:         .|:..:.||    :|.....|:|.||..|.|                  ...
Human   146 PTNWIEGTQAVLRAKKGQDDKV----LVATCTSANGKPPSVVSW------------------ETR 188

  Fly   400 ADGTLQITDVRQEDEGYYVCSAFSVVDSSTVRV-------------FLQVSSLDERPPPIIQIG- 450
            ..|..:..::|..:....|.|.:.:|.|.....             |.:..:|:.:..|.:.|. 
Human   189 LKGEAEYQEIRNPNGTVTVISRYRLVPSREAHQQSLACIVNYHMDRFKESLTLNVQYEPEVTIEG 253

  Fly   451 -PANQTLPKGSVATLPCRATGNPSPRIKWFH----DG---HAVQAGNRYSIIQGSSLRVDDLQLS 507
             ..|..|.:..| .|.|:|..|| |..: :|    :|   ..|:|.||....:|      .:..|
Human   254 FDGNWYLQRMDV-KLTCKADANP-PATE-YHWTTLNGSLPKGVEAQNRTLFFKG------PINYS 309

  Fly   508 DSGTYTCTASGERGETSWAATLTVEKPGSTSLHRAADPSTYPAPP 552
            .:|||.|.|:...|..|          |...::....|.| |:||
Human   310 LAGTYICEATNPIGTRS----------GQVEVNITEFPYT-PSPP 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
robo1NP_476899.1 Ig 56..151 CDD:299845
I-set 56..150 CDD:254352
I-set 157..251 CDD:254352 1/1 (100%)
Ig2_Robo 159..251 CDD:143201 1/1 (100%)
I-set 255..341 CDD:254352 26/119 (22%)
Ig3_Robo 272..341 CDD:143202 21/97 (22%)
IG_like 351..436 CDD:214653 16/97 (16%)
Ig 362..444 CDD:299845 15/94 (16%)
I-set 445..531 CDD:254352 26/94 (28%)
IGc2 459..521 CDD:197706 20/68 (29%)
FN3 549..637 CDD:238020 3/4 (75%)
FN3 673..762 CDD:238020
fn3 770..855 CDD:278470
NECTIN1NP_002846.3 Ig1_Nectin-1_like 45..143 CDD:143294 21/97 (22%)
Ig2_Nectin-1_like 146..243 CDD:143298 20/118 (17%)
Ig 265..330 CDD:319273 23/83 (28%)
Interaction with FGFR. /evidence=ECO:0000250 282..299 4/16 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 399..488
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.