DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment robo1 and LOC563995

DIOPT Version :9

Sequence 1:NP_476899.1 Gene:robo1 / 37603 FlyBaseID:FBgn0005631 Length:1395 Species:Drosophila melanogaster
Sequence 2:XP_021327870.1 Gene:LOC563995 / 563995 -ID:- Length:280 Species:Danio rerio


Alignment Length:221 Identity:52/221 - (23%)
Similarity:82/221 - (37%) Gaps:62/221 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   269 GQTATFHCSVGGDPPP---KVLWKKEEGNIPV-------SRA----------------RILHDEK 307
            |.:....|.|....|.   :|.|::.:....:       |||                .|.|...
Zfish    24 GSSVVLPCYVDEALPVEDLEVEWRRADSETLIHLYQDGESRAEVQQQDYHDRAHFFTEEIQHGNF 88

  Fly   308 SLEISNITPTDEGTYVCEAHN------NVGQISARASLIVHAPPNFTKRPSNKKVG--LNGVVQL 364
            ||.:.|:|..|||.|.|..|:      .|.||.....|:|..        |:|.:.  :.|.:.|
Zfish    89 SLRLDNLTAQDEGEYRCRVHSQQDSGQTVAQIKDVERLLVSG--------SDKSISAYVGGDLTL 145

  Fly   365 PCMASGNPPPSVF---WTKEG-VSTLMFPNSS----------HGR------QHVAADGTLQITDV 409
            .|..:.:..|..|   |.:.| :..|:|.|:.          .||      :....:.:|::..|
Zfish   146 NCFVNSHITPEHFEVSWIRTGEILVLLFQNNETILEAAHEKYRGRVEFFTAEIPKGNFSLRLKSV 210

  Fly   410 RQEDEGYYVCSAFSVVDSSTVRVFLQ 435
            |.||:|.|:|..|:...|:...|.|:
Zfish   211 RIEDKGVYMCQVFAGDLSANATVELE 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
robo1NP_476899.1 Ig 56..151 CDD:299845
I-set 56..150 CDD:254352
I-set 157..251 CDD:254352
Ig2_Robo 159..251 CDD:143201
I-set 255..341 CDD:254352 25/103 (24%)
Ig3_Robo 272..341 CDD:143202 24/100 (24%)
IG_like 351..436 CDD:214653 26/107 (24%)
Ig 362..444 CDD:299845 23/94 (24%)
I-set 445..531 CDD:254352
IGc2 459..521 CDD:197706
FN3 549..637 CDD:238020
FN3 673..762 CDD:238020
fn3 770..855 CDD:278470
LOC563995XP_021327870.1 Ig 24..121 CDD:325142 23/96 (24%)
Ig 140..235 CDD:325142 23/94 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.