Sequence 1: | NP_476899.1 | Gene: | robo1 / 37603 | FlyBaseID: | FBgn0005631 | Length: | 1395 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001161041.1 | Gene: | nectin1b / 557665 | ZFINID: | ZDB-GENE-090224-2 | Length: | 541 | Species: | Danio rerio |
Alignment Length: | 327 | Identity: | 66/327 - (20%) |
---|---|---|---|
Similarity: | 112/327 - (34%) | Gaps: | 94/327 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 269 GQTATFHC-SVGGDPPPK---VLWKK----EEGNIPVS--------------RARILH------- 304
Fly 305 ----DEKSLEISNITPTDEGTYVCE-----AHNNVGQIS----AR--ASLIVHAPPNFTKRPSNK 354
Fly 355 KVGLNGVVQLP---CMASGNPPPSVF-W--TKEGVSTLMFPNSSHGRQHVAADGTLQITDVRQED 413
Fly 414 EGYYVCSAFSVVDSSTVRVFLQVSSLDERPPPIIQIGPANQTLPKGSVATLPCRATGNPSPRI-K 477
Fly 478 WFHDGHAVQAGNRYSIIQGSSLRVDDLQLSDS-------------GTYTCTASGERGETSWAATL 529
Fly 530 TV 531 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
robo1 | NP_476899.1 | Ig | 56..151 | CDD:299845 | |
I-set | 56..150 | CDD:254352 | |||
I-set | 157..251 | CDD:254352 | |||
Ig2_Robo | 159..251 | CDD:143201 | |||
I-set | 255..341 | CDD:254352 | 23/115 (20%) | ||
Ig3_Robo | 272..341 | CDD:143202 | 21/112 (19%) | ||
IG_like | 351..436 | CDD:214653 | 20/90 (22%) | ||
Ig | 362..444 | CDD:299845 | 19/87 (22%) | ||
I-set | 445..531 | CDD:254352 | 19/99 (19%) | ||
IGc2 | 459..521 | CDD:197706 | 14/75 (19%) | ||
FN3 | 549..637 | CDD:238020 | |||
FN3 | 673..762 | CDD:238020 | |||
fn3 | 770..855 | CDD:278470 | |||
nectin1b | NP_001161041.1 | IG_like | 70..183 | CDD:214653 | 21/105 (20%) |
Ig | 80..184 | CDD:299845 | 19/103 (18%) | ||
Ig | 187..283 | CDD:299845 | 21/106 (20%) | ||
IG_like | 304..373 | CDD:214653 | 16/84 (19%) | ||
IGc2 | 304..363 | CDD:197706 | 14/74 (19%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |