| Sequence 1: | NP_476899.1 | Gene: | robo1 / 37603 | FlyBaseID: | FBgn0005631 | Length: | 1395 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001306032.1 | Gene: | OPCML / 4978 | HGNCID: | 8143 | Length: | 354 | Species: | Homo sapiens |
| Alignment Length: | 308 | Identity: | 81/308 - (26%) |
|---|---|---|---|
| Similarity: | 125/308 - (40%) | Gaps: | 55/308 - (17%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 257 FMKEPKDQVMLYGQTATFHCSVGGDPPPKVLWKKEEGNIPVSRARILH----------------- 304
Fly 305 --DEKSLEISNITPTDEGTYVCEAHNNVGQISARASLIVHAPPNFTKRPSNKKVGLNGVVQLPCM 367
Fly 368 ASGNPPPSVFWTKEGVSTLMFPNSSHGRQHVAADGTLQITDVRQEDEGYYVCSAFSVVDSSTVRV 432
Fly 433 FLQVSSLDERPPPIIQIGPANQTLPKGSVATLPCRATGNPSPRIKWFH---------DGHAVQAG 488
Fly 489 NRYSIIQGSSLRVDDLQLSDSGTYTCTASGERGETSWAATLTVEKPGS 536 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| robo1 | NP_476899.1 | Ig | 56..151 | CDD:299845 | |
| I-set | 56..150 | CDD:254352 | |||
| I-set | 157..251 | CDD:254352 | |||
| Ig2_Robo | 159..251 | CDD:143201 | |||
| I-set | 255..341 | CDD:254352 | 22/102 (22%) | ||
| Ig3_Robo | 272..341 | CDD:143202 | 19/87 (22%) | ||
| IG_like | 351..436 | CDD:214653 | 26/84 (31%) | ||
| Ig | 362..444 | CDD:299845 | 25/81 (31%) | ||
| I-set | 445..531 | CDD:254352 | 24/94 (26%) | ||
| IGc2 | 459..521 | CDD:197706 | 18/70 (26%) | ||
| FN3 | 549..637 | CDD:238020 | |||
| FN3 | 673..762 | CDD:238020 | |||
| fn3 | 770..855 | CDD:278470 | |||
| OPCML | NP_001306032.1 | Ig | 44..132 | CDD:416386 | 20/96 (21%) |
| Ig strand A' | 44..49 | CDD:409353 | 0/4 (0%) | ||
| Ig strand B | 51..59 | CDD:409353 | 3/7 (43%) | ||
| CDR1 | 59..63 | CDD:409353 | 1/4 (25%) | ||
| FR2 | 64..70 | CDD:409353 | 2/13 (15%) | ||
| Ig strand C | 64..70 | CDD:409353 | 2/13 (15%) | ||
| CDR2 | 71..83 | CDD:409353 | 3/11 (27%) | ||
| Ig strand C' | 72..76 | CDD:409353 | 1/3 (33%) | ||
| Ig strand C' | 80..83 | CDD:409353 | 0/2 (0%) | ||
| FR3 | 84..118 | CDD:409353 | 8/33 (24%) | ||
| Ig strand D | 87..94 | CDD:409353 | 0/6 (0%) | ||
| Ig strand E | 97..103 | CDD:409353 | 1/5 (20%) | ||
| Ig strand F | 110..118 | CDD:409353 | 4/7 (57%) | ||
| CDR3 | 119..123 | CDD:409353 | 0/3 (0%) | ||
| Ig strand G | 123..132 | CDD:409353 | 2/8 (25%) | ||
| FR4 | 125..132 | CDD:409353 | 2/6 (33%) | ||
| Ig_3 | 135..206 | CDD:404760 | 25/78 (32%) | ||
| Ig strand A | 135..138 | CDD:409353 | 2/2 (100%) | ||
| Ig strand A' | 144..148 | CDD:409353 | 0/3 (0%) | ||
| Ig strand B | 151..160 | CDD:409353 | 3/8 (38%) | ||
| Ig strand C | 165..170 | CDD:409353 | 2/4 (50%) | ||
| Ig strand C' | 171..174 | CDD:409353 | 0/2 (0%) | ||
| Ig strand F | 198..206 | CDD:409353 | 5/7 (71%) | ||
| Ig | 224..312 | CDD:416386 | 24/94 (26%) | ||
| putative Ig strand A | 224..230 | CDD:409353 | 2/7 (29%) | ||
| Ig strand B | 240..244 | CDD:409353 | 1/3 (33%) | ||
| Ig strand C | 253..257 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 279..283 | CDD:409353 | 2/3 (67%) | ||
| Ig strand F | 293..298 | CDD:409353 | 3/4 (75%) | ||
| Ig strand G | 306..309 | CDD:409353 | 0/2 (0%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 0 | 0.000 | |||||