DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment robo1 and DIP-gamma

DIOPT Version :9

Sequence 1:NP_476899.1 Gene:robo1 / 37603 FlyBaseID:FBgn0005631 Length:1395 Species:Drosophila melanogaster
Sequence 2:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster


Alignment Length:445 Identity:102/445 - (22%)
Similarity:162/445 - (36%) Gaps:142/445 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   304 HDEKSLEISNITPTDEGT-YVCEAHNNVGQISARASLIVHAPPNFTKRPSNKKVGLNGVVQLPCM 367
            |.|.|   |.:.|..|.. ::    |||...:.|.:::..:..|..|    .|||          
  Fly    28 HHESS---SQLDPDPEFIGFI----NNVTYPAGREAILACSVRNLGK----NKVG---------- 71

  Fly   368 ASGNPPPSVFWTKEGVSTLMFPNSSHGR--QHVAADGT---------LQITDVRQEDEGYYVCSA 421
                      |.:....|::   :..||  .|.|....         |:|:.:|:.|.|.|:|. 
  Fly    72 ----------WLRASDQTVL---ALQGRVVTHNARISVMHQDMHTWKLKISKLRESDRGCYMCQ- 122

  Fly   422 FSVVDSSTVRVFLQVSSLDERPPP--IIQIGPANQTLPKGSVATLPCRATGNPSPRIKW-FHDGH 483
               :::|.::  .||..:|.:.||  |.:...|:..:.:|..|||.|:|||||.||:.| ..||.
  Fly   123 ---INTSPMK--KQVGCIDVQVPPDIINEESSADLAVQEGEDATLTCKATGNPQPRVTWRREDGE 182

  Fly   484 AV---QAGNR----YSIIQGSSLRVDDLQLSDSGTYTCTASGERGETSWAATLTVEKPGSTSLHR 541
            .:   :.|:|    .....|||||:..|:....|.|.|.||.:                      
  Fly   183 MILIRKPGSRELMKVESYNGSSLRLLRLERRQMGAYLCIASND---------------------- 225

  Fly   542 AADPSTYPAPPGTPKVLNVSRTSISLRWAKSQEKPG-AVGPIIGYTVEY-----FSPDLQTGWIV 600
                    .||...|     |.|:|:::|.....|. .:|..:|..|:.     .||...:.|:.
  Fly   226 --------VPPAVSK-----RVSLSVQFAPMVRAPSQLLGTPLGSDVQLECQVEASPSPVSYWLK 277

  Fly   601 AAQRV-GDTQVTISGLTPGT----------SYVFLVRAENTQGISV-------PSGLSNTIKTIE 647
            .|:.. |...|:.:.|..|:          .|....|.:..:|:.:       ||.:..      
  Fly   278 GARTSNGFASVSTASLESGSPGPEMLLDGPKYGITERRDGYRGVMLLVVRSFSPSDVGT------ 336

  Fly   648 ADFDAASANDLSAARTLLTGKSVEL-IDASAINASAVRLEWMLHVSADEKYVEGL 701
              :...|.|.|..|...|....::| ..|||.|..        |::    |:.||
  Fly   337 --YHCVSTNSLGRAEGTLRLYEIKLHPGASASNDD--------HLN----YIGGL 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
robo1NP_476899.1 Ig 56..151 CDD:299845
I-set 56..150 CDD:254352
I-set 157..251 CDD:254352
Ig2_Robo 159..251 CDD:143201
I-set 255..341 CDD:254352 10/37 (27%)
Ig3_Robo 272..341 CDD:143202 10/37 (27%)
IG_like 351..436 CDD:214653 17/95 (18%)
Ig 362..444 CDD:299845 17/92 (18%)
I-set 445..531 CDD:254352 31/95 (33%)
IGc2 459..521 CDD:197706 28/69 (41%)
FN3 549..637 CDD:238020 22/111 (20%)
FN3 673..762 CDD:238020 8/29 (28%)
fn3 770..855 CDD:278470
DIP-gammaNP_651649.1 IG_like 47..139 CDD:214653 25/124 (20%)
Ig 47..129 CDD:299845 22/112 (20%)
Ig 140..238 CDD:299845 37/132 (28%)
IG_like 247..355 CDD:214653 22/115 (19%)
Ig 256..351 CDD:299845 19/102 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12231
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.