DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment robo1 and DIP-theta

DIOPT Version :9

Sequence 1:NP_476899.1 Gene:robo1 / 37603 FlyBaseID:FBgn0005631 Length:1395 Species:Drosophila melanogaster
Sequence 2:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster


Alignment Length:457 Identity:110/457 - (24%)
Similarity:178/457 - (38%) Gaps:120/457 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   261 PKDQVMLYGQT------ATFHCSVGGDPPPKVLWKKEEGNIPVS----------RARILHDEKS- 308
            ||...:|...|      |...|.|......|:.|.:.:....::          |..|.|.||. 
  Fly   130 PKFGELLQNVTVPVSREAVLQCVVDNLQTYKIAWLRVDTQTILTIQNHVITKNHRMSITHAEKRA 194

  Fly   309 --LEISNITPTDEGTYVCEAH-----NNVGQISARASLIVHAPPNFTKRPSNK----KVGLNGVV 362
              |.|.::..:|:|.|:|:.:     :.||.:.      |..||:....|::.    :.|.|  |
  Fly   195 WILRIRDVKESDKGWYMCQINTDPMKSQVGYLD------VVVPPDILDYPTSTDMVIREGSN--V 251

  Fly   363 QLPCMASGNPPPSVFWTKEGVSTLMFPNSSHGRQHVAADGT-LQITDVRQEDEGYYVCSAFS-VV 425
            .|.|.|:|:|.|::.|.:||...:..||   |.:.||.:|: |.|..|.:.:.|.|:|.|.: :.
  Fly   252 TLKCAATGSPTPTITWRREGGELIPLPN---GAEAVAYNGSFLTIAKVNRLNMGAYLCIASNGIP 313

  Fly   426 DSSTVRVFLQVSSLDERPPPIIQIGPANQTLPKGSV----ATLPCRATGNPSPRIKWFHDGHAVQ 486
            .:.:.||.|.|..     ||:|.|  .||.:  |:.    .||.|::...|.....|..:...:.
  Fly   314 PTVSKRVMLIVHF-----PPMIWI--QNQLV--GAALTQNITLECQSEAYPKSINYWMKNDTIIV 369

  Fly   487 AGNR---------YSIIQGSSLRVDDLQLSDSGTYTCTASGERGETSWAATLTVEKPGSTSLHRA 542
            .|.|         |.|..  .|.:.::.:.|.|.|.|.|....|:|..|..| ...|.:|::   
  Fly   370 PGERFVPETFESGYKITM--RLTIYEVDIQDFGAYRCVAKNSLGDTDGAIKL-YHIPQTTTM--- 428

  Fly   543 ADPSTYPAPPGTPKVLNVSRTSISLRWAKSQEKPGAVGPIIGYTVEYFSPDLQTGWIVAAQRVGD 607
                |..||       .||..::.:             .::.|..|              ||.|.
  Fly   429 ----TTMAP-------TVSINTVPV-------------VLVKYNKE--------------QRYGS 455

  Fly   608 TQVTIS---GLTPGTSY--VFLVRAE-NTQGI-SVPSGLSNTIKTIEA------DFDAASANDLS 659
            :|.:.:   ...||.|.  ..|.|.: |::|. ..||||:|......:      |..::|::..|
  Fly   456 SQNSNTNPYNFNPGNSQQNTKLQRGKSNSKGSDQSPSGLNNVFVGATSSLWNSQDHHSSSSSSSS 520

  Fly   660 AA 661
            |:
  Fly   521 AS 522

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
robo1NP_476899.1 Ig 56..151 CDD:299845
I-set 56..150 CDD:254352
I-set 157..251 CDD:254352
Ig2_Robo 159..251 CDD:143201
I-set 255..341 CDD:254352 22/103 (21%)
Ig3_Robo 272..341 CDD:143202 18/86 (21%)
IG_like 351..436 CDD:214653 29/90 (32%)
Ig 362..444 CDD:299845 27/83 (33%)
I-set 445..531 CDD:254352 25/98 (26%)
IGc2 459..521 CDD:197706 16/74 (22%)
FN3 549..637 CDD:238020 17/94 (18%)
FN3 673..762 CDD:238020
fn3 770..855 CDD:278470
DIP-thetaNP_723103.1 Ig 137..230 CDD:299845 20/98 (20%)
IG_like 137..230 CDD:214653 20/98 (20%)
IG_like 240..324 CDD:214653 28/88 (32%)
IGc2 247..310 CDD:197706 25/67 (37%)
Ig 327..419 CDD:299845 25/97 (26%)
IG_like 343..420 CDD:214653 19/79 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12231
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.