DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment robo1 and CG15312

DIOPT Version :10

Sequence 1:NP_476899.1 Gene:robo1 / 37603 FlyBaseID:FBgn0005631 Length:1395 Species:Drosophila melanogaster
Sequence 2:NP_001245603.1 Gene:CG15312 / 31940 FlyBaseID:FBgn0030174 Length:464 Species:Drosophila melanogaster


Alignment Length:556 Identity:110/556 - (19%)
Similarity:167/556 - (30%) Gaps:232/556 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   458 KGSVATLPCRATGNPSPRIKWFHDGHAVQAGNRYSIIQ-GSSLRVDDLQLSDSGTYTCTASGERG 521
            ||...::||.|.||    |.|..: |    ||..:|:| |..|.:.::..:|:|.|.|.||..|.
  Fly    39 KGGNVSIPCIAQGN----IMWVKE-H----GNNSTIVQTGRVLVLRNVSTTDAGIYVCFASVPRP 94

  Fly   522 ETSWAATLTVEKPGSTSLHRAADPSTYP--------APPGTPK--------------VLNVSRTS 564
            .|:  ||     ..:||.....|..|.|        ....:||              .|...||.
  Fly    95 STT--AT-----SATTSPQNLQDKETRPLEDEDDGQGESVSPKDDQLKEAEMEEEVEYLAHQRTK 152

  Fly   565 ISLR---------------------WAKSQEKPGAVGPIIGYTVEYFSPDLQT---------GW- 598
            :.:|                     |..::.:.|.. |:..:|.||.:...:|         .| 
  Fly   153 LIVRTVPGPVSQLYFKASTILGFLIWRFNKTQSGGY-PVRSFTAEYRNVSYKTPPANASFEHAWS 216

  Fly   599 ----IVAAQRVGDTQVTISGLTPGTSYVFLVRAENTQGISVPSG---------LSNT-----IKT 645
                |..|..|  .|:.:..|.|.|:|.|.:.|.|..|    ||         |..|     |:.
  Fly   217 RMDPINIAFNV--RQMEVYRLAPNTTYEFRIWANNELG----SGEVVTTNVTTLPETKEEDLIRL 275

  Fly   646 IEADFDAASANDLSAARTLLTGKSVELIDASAINASAVRLEWMLHVSADEKYVEGLRIHYKDASV 710
            |:.|.|.........|.:::.|..|.|    ||                     ||.|.......
  Fly   276 IKPDLDNFDPRIWIVAVSIVLGTLVIL----AI---------------------GLCIVLSKECY 315

  Fly   711 PSAQYHSITVMDASAESFVVGNLKKYTKYEFFLTPFFETIEGQP-----SNSKTALTY------- 763
            .|||   :.:.|......::.|:        .|.|.|...:|.|     .:..:|...       
  Fly   316 QSAQ---MELQDGWDSIELIPNI--------ILNPGFSESDGGPEPGGQGHGGSAGDQDAGEDDD 369

  Fly   764 EDVPSAPPDNIQIGMYNQTAGWVRWTPPPSQHHNGNLYGYKIEVSAGNTMKVLANMTLNATTTSV 828
            :||....|..|..|.:::       ||||.:.|                                
  Fly   370 DDVAMPFPRTIIFGQHHR-------TPPPPRLH-------------------------------- 395

  Fly   829 LLNNLTTGAVYSVRLNSFTKAGDGPYSKPISLFMDPTHHVHPPRAHPSGTHDGRHEGQDLTYHNN 893
                                             :.|.||.|..::|    |...|..|:...|::
  Fly   396 ---------------------------------LPPQHHRHQNQSH----HHQYHHQQNQQQHHH 423

  Fly   894 GNIPPGDIN----------PTTH---KKTTDYLSGP 916
            .::...|.:          ||..   :|.:.:.:||
  Fly   424 HHLRRQDDDDDDDYEEEHEPTMERFKRKVSVFFTGP 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
robo1NP_476899.1 Ig 56..151 CDD:472250
Ig strand B 73..77 CDD:409353
Ig strand C 86..90 CDD:409353
Ig strand E 111..115 CDD:409353
Ig strand F 129..134 CDD:409353
Ig strand G 143..146 CDD:409353
IgI_2_Robo 158..251 CDD:409389
Ig strand A 158..161 CDD:409389
Ig strand A' 163..167 CDD:409389
Ig strand B 171..178 CDD:409389
Ig strand C 186..191 CDD:409389
Ig strand C' 193..196 CDD:409389
Ig strand D 209..213 CDD:409389
Ig strand E 216..222 CDD:409389
Ig strand F 229..237 CDD:409389
Ig strand G 240..251 CDD:409389
IgI_3_Robo 258..341 CDD:409390
Ig strand A 258..261 CDD:409390
Ig strand A' 263..267 CDD:409390
Ig strand B 270..279 CDD:409390
Ig strand C 285..290 CDD:409390
Ig strand C' 293..296 CDD:409390
Ig strand D 299..304 CDD:409390
Ig strand E 305..313 CDD:409390
Ig strand F 320..328 CDD:409390
Ig strand G 331..341 CDD:409390
Ig 346..437 CDD:472250
Ig strand B 362..366 CDD:409353
Ig strand C 375..379 CDD:409353
Ig strand E 402..406 CDD:409353
Ig strand F 416..421 CDD:409353
Ig strand G 429..432 CDD:409353
Ig 446..531 CDD:472250 26/73 (36%)
Ig strand B 462..466 CDD:409544 0/3 (0%)
Ig strand C 475..479 CDD:409544 1/3 (33%)
Ig strand E 497..501 CDD:409544 1/3 (33%)
FN3 507..>916 CDD:442628 92/504 (18%)
Ig strand F 511..516 CDD:409544 2/4 (50%)
Ig strand G 524..527 CDD:409544 0/2 (0%)
FN3 549..637 CDD:238020 27/144 (19%)
fn3 770..855 CDD:394996 8/84 (10%)
CG15312NP_001245603.1 Ig 39..90 CDD:472250 20/59 (34%)
Ig strand B 43..47 CDD:409358 0/3 (0%)
Ig strand C 52..56 CDD:409358 2/7 (29%)
Ig strand F 84..89 CDD:409358 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.