DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment robo1 and DIP-lambda

DIOPT Version :9

Sequence 1:NP_476899.1 Gene:robo1 / 37603 FlyBaseID:FBgn0005631 Length:1395 Species:Drosophila melanogaster
Sequence 2:NP_001334747.1 Gene:DIP-lambda / 26067049 FlyBaseID:FBgn0267428 Length:548 Species:Drosophila melanogaster


Alignment Length:553 Identity:119/553 - (21%)
Similarity:213/553 - (38%) Gaps:97/553 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   232 KCIA-QNLVGTRESSYAKLIVQVKPYFMKEPKDQVMLYGQTATFHCSVGGDPPPKVLWKKEEG-- 293
            ||.| .::.|..||.      ::.|.|:.:..:..:..|:..:|.|.|......:|.|.|.:.  
  Fly    32 KCHAVAHIHGKGESE------EIDPQFLAKLSNTTVPIGRDISFTCVVDNLGHYRVAWIKSDSKA 90

  Fly   294 -----------NIPVSRARILHDEKSLEISNITPTDEGTYVCEAHNN-VGQISARASLIVHAPPN 346
                       |..:|.....|:...|.||.:...|.|:|:|:.:.: :..:|....::|  ||:
  Fly    91 ILGIHTHMVSLNPRLSVTHNGHNTWKLHISRVQINDSGSYMCQVNTDPMKSLSGYLDVVV--PPD 153

  Fly   347 FTKRPS-NKKVGL---NGVVQLPCMASGNPPPSVFWTKEGVSTLMFPNSSHGRQHV---AADG-T 403
            ....|. |.:.|:   .|.:.|.|..:|.|.|.|.|.:|....::.  .:.||...   :.:| .
  Fly   154 ILNHPEHNPEDGVCQEGGSISLMCSVTGVPRPKVLWRREAGKEIIL--RTDGRDKTGFKSVEGER 216

  Fly   404 LQITDVRQEDEGYYVCSAFSVVDSSTVRVFLQVSSLDERPPPIIQIGPANQTLPKGSVATLPCRA 468
            |.:|:|::.|.|.|.|.|.:.:..|..:.|....:.......|.|:..|    |.....||.|..
  Fly   217 LVLTNVQRSDMGGYNCIASNGIPPSVSKRFNVYVNFSPTVKAISQLVGA----PVEREVTLECIV 277

  Fly   469 TGNPSPRIKWFH-DGH-AVQAGNRYSIIQ--------GSSLRVDDLQLSDSGTYTCTASGERGET 523
            ...|.|...|:. :|: .:..||:|:|.:        ..:|.:..|..||.|||:|::....|: 
  Fly   278 EVFPKPLNGWYRSEGNIKLHNGNKYNISEEVINIYTWHLNLTIRHLTKSDFGTYSCSSVNALGK- 341

  Fly   524 SWAATLTVEKPGSTSLHRAADPSTYPAPPGTPKVLNVSRTSISLRWAKSQEKPGAVGPIIGYTVE 588
                        |.||.|..:....|....|| ..::..|..|.|...:..|.| :..::.:...
  Fly   342 ------------SESLIRLQELRLPPKLTTTP-TPHMQTTGKSRRKHPASHKKG-LNEVLRFQET 392

  Fly   589 YFSPDLQTGWIVAAQRVGDTQVTISGLTPGTSYVFLVRAENTQGISVPSGLSNTIKTIEADFDAA 653
            :|:..:|       |...|.       ..|...:....:||: .|.:.||..|::         .
  Fly   393 HFANQIQ-------QENEDH-------NEGFDLLKFTNSENS-NIVLESGHINSM---------I 433

  Fly   654 SANDLSAARTLLTGKSVELIDASAINASAVRLEWMLHVSADEKYVEGLRIHYKDASVPS------ 712
            :..|::.......|:  |..:..:....:.|..|:|..:..::  ..|..:...|.:.|      
  Fly   434 NKEDVNIYHPKQYGQ--EKTNKPSGTIPSTRTPWILTNAGSQR--PALTSYATVALITSFWLFFW 494

  Fly   713 AQYHSITVMDASAESFVVGNLKKYTKYEFFLTP 745
            ..:||:. .||...|.||.::..:.:..:|..|
  Fly   495 RVFHSLD-WDAIRVSSVVHHVVVFKRRSYFEAP 526

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
robo1NP_476899.1 Ig 56..151 CDD:299845
I-set 56..150 CDD:254352
I-set 157..251 CDD:254352 6/19 (32%)
Ig2_Robo 159..251 CDD:143201 6/19 (32%)
I-set 255..341 CDD:254352 20/99 (20%)
Ig3_Robo 272..341 CDD:143202 17/82 (21%)
IG_like 351..436 CDD:214653 25/92 (27%)
Ig 362..444 CDD:299845 21/85 (25%)
I-set 445..531 CDD:254352 24/95 (25%)
IGc2 459..521 CDD:197706 19/71 (27%)
FN3 549..637 CDD:238020 16/87 (18%)
FN3 673..762 CDD:238020 15/79 (19%)
fn3 770..855 CDD:278470
DIP-lambdaNP_001334747.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12231
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.