DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment robo1 and NECTIN3

DIOPT Version :9

Sequence 1:NP_476899.1 Gene:robo1 / 37603 FlyBaseID:FBgn0005631 Length:1395 Species:Drosophila melanogaster
Sequence 2:XP_011510965.1 Gene:NECTIN3 / 25945 HGNCID:17664 Length:580 Species:Homo sapiens


Alignment Length:364 Identity:82/364 - (22%)
Similarity:133/364 - (36%) Gaps:87/364 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 PAWLLLVLVASNGL--PAVRGQYQSPRIIEHPTDLVVKKNEPATLNC--------------KVEG 81
            |.::||..::...|  .|:.|    |.|:|.....|..||  .:|.|              |:.|
Human    69 PPFILLNKLSREDLLHCALAG----PIIVEPHVTAVWGKN--VSLKCLIEVNETITQISWEKIHG 127

  Fly    82 KPEPTIEWFKDGEPVSTNEKKSHRVQFK-----DGALFFYRTMQGKKEQDGGEYWCVAKN-RVGQ 140
            |...|:.........|...:...||.||     |..:    |:......|.|:|.|.|.. .:|.
Human   128 KSSQTVAVHHPQYGFSVQGEYQGRVLFKNYSLNDATI----TLHNIGFSDSGKYICKAVTFPLGN 188

  Fly   141 AVSRHASLQIAVLRDDFRVEPKDTRVAKGETALLE---------CGPPKGIPEPTLIWIKDGVPL 196
            |.|   |..:.||     ||| ...:.||..:|::         |....|.|...:.|  :|   
Human   189 AQS---STTVTVL-----VEP-TVSLIKGPDSLIDGGNETVAAICIAATGKPVAHIDW--EG--- 239

  Fly   197 DDLKAMSFGASSRVRIVDGGNLLISNVEPIDEGNYK-------------CIAQNLVGTRESSYAK 248
             ||..|.   |:.....:....:||        .||             |:.::....::..|:.
Human   240 -DLGEME---STTTSFPNETATIIS--------QYKLFPTRFARGRRITCVVKHPALEKDIRYSF 292

  Fly   249 LI-VQVKPYFMKEPKDQVMLYGQT-ATFHCSVGGDPPP-KVLWKKEEGNIPVSRARILHDEKSLE 310
            :: :|..|.......|.....|:. ....|:...:||| |.:|.:.:|..|..   :|..:.:|.
Human   293 ILDIQYAPEVSVTGYDGNWFVGRKGVNLKCNADANPPPFKSVWSRLDGQWPDG---LLASDNTLH 354

  Fly   311 -ISNITPTDEGTYVCEAHNNVGQISARASLIVHAPPNFT 348
             :..:|....|.|:|:..|::||.|.:..:.:..||..|
Human   355 FVHPLTFNYSGVYICKVTNSLGQRSDQKVIYISDPPTTT 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
robo1NP_476899.1 Ig 56..151 CDD:299845 28/114 (25%)
I-set 56..150 CDD:254352 28/113 (25%)
I-set 157..251 CDD:254352 21/116 (18%)
Ig2_Robo 159..251 CDD:143201 21/114 (18%)
I-set 255..341 CDD:254352 21/88 (24%)
Ig3_Robo 272..341 CDD:143202 18/70 (26%)
IG_like 351..436 CDD:214653
Ig 362..444 CDD:299845
I-set 445..531 CDD:254352
IGc2 459..521 CDD:197706
FN3 549..637 CDD:238020
FN3 673..762 CDD:238020
fn3 770..855 CDD:278470
NECTIN3XP_011510965.1 IG_like 95..197 CDD:214653 25/110 (23%)
Ig1_Nectin-3_like 103..198 CDD:143295 24/103 (23%)
Ig 201..296 CDD:299845 19/112 (17%)
IG_like 318..379 CDD:214653 17/63 (27%)
Ig_3 <318..373 CDD:290638 14/57 (25%)
TM_EGFR-like 435..463 CDD:213052
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.