DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment robo1 and Bsg

DIOPT Version :9

Sequence 1:NP_476899.1 Gene:robo1 / 37603 FlyBaseID:FBgn0005631 Length:1395 Species:Drosophila melanogaster
Sequence 2:NP_001103352.1 Gene:Bsg / 25246 RGDID:2220 Length:388 Species:Rattus norvegicus


Alignment Length:380 Identity:79/380 - (20%)
Similarity:131/380 - (34%) Gaps:115/380 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   257 FMKEPKDQVMLYGQTATFHCSVGGDPPPKVLWKKEEGNIP------------VSRARI-----LH 304
            |:|.|..|....|.:...||...|.|.|::.| ..|||.|            :.|..|     .|
  Rat    25 FLKAPMSQEQWAGGSVVLHCEAVGSPMPEIQW-WFEGNEPNDSCSQLWDGARLDRVHIHATYRQH 88

  Fly   305 DEKSLEISNITPTDEGTYVCEAHNN-----------VGQISARASLIVHAPPNFTKRPSNKKVGL 358
            ...:|.:..:...|.|||.|.|.::           |..:.|:||::|..|.........    :
  Rat    89 AASTLSVDGLAAEDTGTYECRASSDPDRNHLTRPPRVKWVRAQASVVVLEPGTIVTSVQE----V 149

  Fly   359 NGVVQLPCM--ASGNPPPSVFWTKEGVSTLMFPNSSHGRQHVAADGTLQITDVRQEDEGYYVCSA 421
            :...||.|.  :||.......|.:.|...         ::....|..::.|....:..|.|.|  
  Rat   150 DSKTQLTCFLNSSGIDIVGHRWMRGGKVL---------QEDTLPDLQMKYTVDADDRSGEYSC-- 203

  Fly   422 FSVVDSSTVRVFLQV----SSLDERPPPIIQIGPANQTLPKGSVATLPCRATGNPSPRIKWF--- 479
                      :||..    .:::...||.|::|..::...:|....|.|::..:..|..:|.   
  Rat   204 ----------IFLPEPVGRGNINVEGPPRIKVGKKSEHASEGEFVKLICKSEASHPPVDEWVWFK 258

  Fly   480 -HD------GHAVQAGNRYSII---QGSSLRVDDLQLS-DSGTYTCTASGERGETSWAATLTVEK 533
             .|      .:..:|.::|.||   :.|.|.:.||.:: |.|||.|.|:..:|.           
  Rat   259 TSDTGDQTISNGTEANSKYVIISTPELSELIISDLDMNVDPGTYVCNATNSQGS----------- 312

  Fly   534 PGSTSLHRAADPSTYPAPPGTPKVLNVSRTSISLRWAKSQEKPGAVGPIIGYTVE 588
                                       :|.:||||   .:.:..|:.|.:|...|
  Rat   313 ---------------------------ARETISLR---VRSRLAALWPFLGIVAE 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
robo1NP_476899.1 Ig 56..151 CDD:299845
I-set 56..150 CDD:254352
I-set 157..251 CDD:254352
Ig2_Robo 159..251 CDD:143201
I-set 255..341 CDD:254352 29/111 (26%)
Ig3_Robo 272..341 CDD:143202 24/96 (25%)
IG_like 351..436 CDD:214653 14/86 (16%)
Ig 362..444 CDD:299845 14/87 (16%)
I-set 445..531 CDD:254352 24/99 (24%)
IGc2 459..521 CDD:197706 20/75 (27%)
FN3 549..637 CDD:238020 9/40 (23%)
FN3 673..762 CDD:238020
fn3 770..855 CDD:278470
BsgNP_001103352.1 IG_like 29..113 CDD:214653 23/84 (27%)
Ig 40..111 CDD:143165 19/71 (27%)
Ig 139..203 CDD:299845 12/76 (16%)
IG_like 228..321 CDD:214653 26/133 (20%)
Ig 238..318 CDD:143165 21/117 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 355..388
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.